| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 |
| | MTIIYGQDIGLIHQKLSQIKSNSPYKTIWFKDLKQLYDLFSQPLFGSNNEKFIVNNCSFLEKTSLTRQENLCLEKLKTTDVVLTVYTDNPFSGIKTIKSITTVFCDKLDWKSMHKAIGEVCRELNLKLDLEIIDWLANALPLNMGVIYQEINKLSLLGKNEIKDNKLVETVICDYQPVQIYKLTKALTNSQIVKAFKYIDELASTKPNFATQFLEFFSGELLLALMVKSCNPKQLTNINLNVNQFRLIAIQSQYHNFTSKVLVNIINAIQKLDIKLKHNDGFAIPLLKNFALSFFTN |
| tmhmm (0) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (5%) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXX----------------------------------------XX---------------- |
| psipred | -EEEE---HHHHHHHHHHHHHH----EEEHHHHHHHHHHHH--------EEEEEE-----------HHHHHHHH------EEEEEEE---HHHHHHHHH-EEEEEE---HHHHHHHHHHHHHH------HHHHHHHHHHH-HHHHHHHHHHHHHHH--------HHHHHHHH-------HHHHHHHHH---HHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHH----HHHHHHHH----HHHHHHHHHHHH---HHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHH-- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 663918 | Mycoplasma genitalium M2321 | 1 (0.03%) | 2E-66 | 1-297 | 1-297 | 258 | 100 | 297 | ref|NP_072982.1| | DNA polymerase III subunit delta, [Mycoplasma genitalium G37... |
| 662946 | Mycoplasma genitalium M6282 | 1 (0.03%) | 6E-66 | 1-297 | 1-297 | 257 | 100 | 297 | ref|YP_006600345.1| | DNA polymerase III subunit delta [Mycoplasma genitalium M628... |
| 662945 | Mycoplasma genitalium M6320 | 1 (0.03%) | 1E-65 | 1-297 | 1-297 | 256 | 100 | 297 | ref|YP_006600849.1| | DNA polymerase III subunit delta [Mycoplasma genitalium M632... |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.03%) | 9E-59 | 1-272 | 1-272 | 233 | 99 | 272 | ref|YP_006601353.1| | DNA polymerase III subunit delta [Mycoplasma genitalium M228... |
| 1112856 | Mycoplasma pneumoniae 309 | 1 (0.03%) | 8E-66 | 1-296 | 16-312 | 256 | 47 | 297 | ref|NP_110138.1| | hypothetical protein MPN450 [Mycoplasma pneumoniae M129] ref... |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.03%) | 7E-64 | 1-296 | 1-297 | 250 | 47 | 297 | ref|YP_007348037.1| | DNA polymerase III, delta subunit [Mycoplasma pneumoniae M12... |
| 2104 | Mycoplasma pneumoniae | 1 (0.03%) | 1E-63 | 1-296 | 1-297 | 249 | 47 | 297 | ref|WP_017532757.1| | hypothetical protein [Mycoplasma pneumoniae] |
| 722438 | Mycoplasma pneumoniae FH | 1 (0.03%) | 2E-52 | 39-296 | 2-259 | 212 | 47 | 258 | ref|YP_005881456.1| | DNA polymerase III subunit delta [Mycoplasma pneumoniae FH] ... |
| 28901 | Salmonella enterica | 1 (0.03%) | 4E-6 | 115-181 | 1-67 | 59 | 22 | 67 | ref|WP_000308787.1| | hypothetical protein, partial [Salmonella enterica] |
| 518637 | Eubacterium biforme DSM 3989 | 1 (0.03%) | 4E-51 | 1-297 | 3-312 | 208 | 21 | 314 | ref|WP_003864931.1| | hypothetical protein, partial [[Eubacterium] biforme] gb|EEC... |
| 1234593 | Staphylococcus sp. E463 | 1 (0.03%) | 2E-35 | 114-294 | 1-185 | 156 | 21 | 186 | ref|WP_017636292.1| | DNA polymerase III subunit delta, partial [Staphylococcus sp... |
| 661367 | Legionella longbeachae NSW150 | 1 (0.03%) | 1E-23 | 1-295 | 19-330 | 117 | 21 | 317 | ref|YP_003455800.1| | DNA polymerase III, delta subunit [Legionella longbeachae NS... |
| 161544 | Bacillus sp. SG-1 | 1 (0.03%) | 2E-64 | 1-294 | 22-341 | 252 | 20 | 322 | ref|WP_006837742.1| | DNA polymerase III subunit delta [Bacillus sp. SG-1] gb|EDL6... |
| 997296 | Bacillus methanolicus PB1 | 1 (0.03%) | 2E-61 | 1-294 | 17-336 | 241 | 20 | 322 | ref|WP_004438047.1| | DNA polymerase III subunit delta [Bacillus methanolicus] gb|... |
| 649349 | Leadbetterella byssophila DSM 17132 | 1 (0.03%) | 2E-57 | 1-296 | 18-337 | 229 | 20 | 322 | ref|YP_003997104.1| | DNA polymerase III subunit delta [Leadbetterella byssophila ... |
| 904795 | Staphylococcus aureus subsp. aureus CO-23 | 1 (0.03%) | 7E-38 | 108-294 | 1-191 | 164 | 20 | 192 | ref|WP_001794778.1| | DNA polymerase III subunit delta [Staphylococcus aureus] gb|... |
| 911238 | Staphylococcus simiae CCM 7213 | 1 (0.03%) | 1E-37 | 108-294 | 1-191 | 163 | 20 | 192 | ref|WP_002462438.1| | DNA polymerase III subunit delta [Staphylococcus simiae] gb|... |
| 904781 | Staphylococcus aureus subsp. aureus IS-105 | 2 (0.06%) | 4E-34 | 127-294 | 4-175 | 151 | 20 | 173 | ref|WP_000316011.1| | hypothetical protein, partial [Staphylococcus aureus] gb|EHS... |
| 706194 | Candidatus Sulcia muelleri CARI | 1 (0.03%) | 1E-11 | 51-297 | 1-241 | 78 | 20 | 256 | ref|YP_003880773.1| | hypothetical protein SMCARI_281 [Candidatus Sulcia muelleri ... |
| 45361 | Mycoplasma conjunctivae | 1 (0.03%) | 3E-11 | 58-296 | 3-253 | 76 | 20 | 253 | ref|YP_002960566.1| | hypothetical protein MCJ_000470 [Mycoplasma conjunctivae HRC... |