old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290
	MTIIYGQDIGLIHQKLSQIKSNSPYKTIWFKDLKQLYDLFSQPLFGSNNEKFIVNNCSFLEKTSLTRQENLCLEKLKTTDVVLTVYTDNPFSGIKTIKSITTVFCDKLDWKSMHKAIGEVCRELNLKLDLEIIDWLANALPLNMGVIYQEINKLSLLGKNEIKDNKLVETVICDYQPVQIYKLTKALTNSQIVKAFKYIDELASTKPNFATQFLEFFSGELLLALMVKSCNPKQLTNINLNVNQFRLIAIQSQYHNFTSKVLVNIINAIQKLDIKLKHNDGFAIPLLKNFALSFFTN
tmhmm (0)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (5%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXX----------------------------------------XX----------------
psipred	-EEEE---HHHHHHHHHHHHHH----EEEHHHHHHHHHHHH--------EEEEEE-----------HHHHHHHH------EEEEEEE---HHHHHHHHH-EEEEEE---HHHHHHHHHHHHHH------HHHHHHHHHHH-HHHHHHHHHHHHHHH--------HHHHHHHH-------HHHHHHHHH---HHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHH----HHHHHHHH----HHHHHHHHHHHH---HHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHH--

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    47	    0.141
  max. Y    47	    0.125
  max. S    45	    0.137
  mean S     1-46   0.100
       D     1-46   0.113    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.113 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-297	alignment	3zh9B_101	1-339	0.8426	HYDROLASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
663918	Mycoplasma genitalium M2321	1 (0.03%)	2E-66	1-297	1-297	258	100	297	ref|NP_072982.1|	DNA polymerase III subunit delta, [Mycoplasma genitalium G37...
662946	Mycoplasma genitalium M6282	1 (0.03%)	6E-66	1-297	1-297	257	100	297	ref|YP_006600345.1|	DNA polymerase III subunit delta [Mycoplasma genitalium M628...
662945	Mycoplasma genitalium M6320	1 (0.03%)	1E-65	1-297	1-297	256	100	297	ref|YP_006600849.1|	DNA polymerase III subunit delta [Mycoplasma genitalium M632...
662947	Mycoplasma genitalium M2288	1 (0.03%)	9E-59	1-272	1-272	233	99	272	ref|YP_006601353.1|	DNA polymerase III subunit delta [Mycoplasma genitalium M228...
1112856	Mycoplasma pneumoniae 309	1 (0.03%)	8E-66	1-296	16-312	256	47	297	ref|NP_110138.1|	hypothetical protein MPN450 [Mycoplasma pneumoniae M129] ref...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	7E-64	1-296	1-297	250	47	297	ref|YP_007348037.1|	DNA polymerase III, delta subunit [Mycoplasma pneumoniae M12...
2104	Mycoplasma pneumoniae	1 (0.03%)	1E-63	1-296	1-297	249	47	297	ref|WP_017532757.1|	hypothetical protein [Mycoplasma pneumoniae]
722438	Mycoplasma pneumoniae FH	1 (0.03%)	2E-52	39-296	2-259	212	47	258	ref|YP_005881456.1|	DNA polymerase III subunit delta [Mycoplasma pneumoniae FH] ...
28901	Salmonella enterica	1 (0.03%)	4E-6	115-181	1-67	59	22	67	ref|WP_000308787.1|	hypothetical protein, partial [Salmonella enterica]
518637	Eubacterium biforme DSM 3989	1 (0.03%)	4E-51	1-297	3-312	208	21	314	ref|WP_003864931.1|	hypothetical protein, partial [[Eubacterium] biforme] gb|EEC...
1234593	Staphylococcus sp. E463	1 (0.03%)	2E-35	114-294	1-185	156	21	186	ref|WP_017636292.1|	DNA polymerase III subunit delta, partial [Staphylococcus sp...
661367	Legionella longbeachae NSW150	1 (0.03%)	1E-23	1-295	19-330	117	21	317	ref|YP_003455800.1|	DNA polymerase III, delta subunit [Legionella longbeachae NS...
161544	Bacillus sp. SG-1	1 (0.03%)	2E-64	1-294	22-341	252	20	322	ref|WP_006837742.1|	DNA polymerase III subunit delta [Bacillus sp. SG-1] gb|EDL6...
997296	Bacillus methanolicus PB1	1 (0.03%)	2E-61	1-294	17-336	241	20	322	ref|WP_004438047.1|	DNA polymerase III subunit delta [Bacillus methanolicus] gb|...
649349	Leadbetterella byssophila DSM 17132	1 (0.03%)	2E-57	1-296	18-337	229	20	322	ref|YP_003997104.1|	DNA polymerase III subunit delta [Leadbetterella byssophila ...
904795	Staphylococcus aureus subsp. aureus CO-23	1 (0.03%)	7E-38	108-294	1-191	164	20	192	ref|WP_001794778.1|	DNA polymerase III subunit delta [Staphylococcus aureus] gb|...
911238	Staphylococcus simiae CCM 7213	1 (0.03%)	1E-37	108-294	1-191	163	20	192	ref|WP_002462438.1|	DNA polymerase III subunit delta [Staphylococcus simiae] gb|...
904781	Staphylococcus aureus subsp. aureus IS-105	2 (0.06%)	4E-34	127-294	4-175	151	20	173	ref|WP_000316011.1|	hypothetical protein, partial [Staphylococcus aureus] gb|EHS...
706194	Candidatus Sulcia muelleri CARI	1 (0.03%)	1E-11	51-297	1-241	78	20	256	ref|YP_003880773.1|	hypothetical protein SMCARI_281 [Candidatus Sulcia muelleri ...
45361	Mycoplasma conjunctivae	1 (0.03%)	3E-11	58-296	3-253	76	20	253	ref|YP_002960566.1|	hypothetical protein MCJ_000470 [Mycoplasma conjunctivae HRC...