old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 .
	MFDISKDFVSIFYRKETLKNCMFGIIGSRSETTLRQQNDKDWSFFVNDANRITGFNFFNIKKSFKKFFLSHRFNEGLNYPSLKIMKRISELLGYDLISLANKVPFVVCEVVSVIPIANTHLKRCKVNTGLTKSLDIVCGANNVRVGMKTVLVQVGGVLPSGTVIKKTKIAGFDSVGMLCSEKELNLKQKNEGIIEINPKIKVGKPFIDVYLNKQHSKWVNTKKRVKLS
tmhmm (0)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (6%)	------------------------------------------------------XXXXXXXXXXXXXX----------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (2%)	XXXX--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	-------EEEEEE-------EEEEEE------EEEEEE---EEEEE-----EEEEEEE-HHHH--HHHH---------HHHHHHHHHHHEE--EEEEEE-----EEEEEEEEEEE-----EEEEEEEE----EEEEE-----EE---EEEEEE--------EEEEE-----EEE--EE--HHH---------EEE----------HHHHH-----EEEEE--------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    52	    0.114
  max. Y    36	    0.140
  max. S    35	    0.308
  mean S     1-35   0.146
       D     1-35   0.142    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.142 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-228	alignment	2e8gA_310	1-240	0.7346	RNA BINDING PROTEIN

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	5E-55	1-228	1-228	220	100	228	ref|YP_006599993.1|	hypothetical protein CM9_02645 [Mycoplasma genitalium M2321]...
66084	Wolbachia sp. wRi	1 (0.03%)	1E-41	64-224	3-162	175	39	167	ref|YP_002726928.1|	Phenylalanyl-tRNA synthetase beta chain [Wolbachia sp. wRi] ...
569881	Wolbachia endosymbiont of Culex quinquefasciatus JHB	1 (0.03%)	9E-42	64-224	3-162	176	38	167	ref|YP_001975391.1|	phenylalanyl-tRNA synthetase subunit beta [Wolbachia endosym...
564608	Micromonas pusilla CCMP1545	5 (0.13%)	2E-28	103-204	323-426	132	38	104	ref|XP_003055425.1|	translation initiation factor [Micromonas pusilla CCMP1545] ...
434131	Neorickettsia risticii str. Illinois	1 (0.03%)	6E-40	64-224	3-159	170	36	165	ref|YP_003081624.1|	phenylalanyl-tRNA synthetase, beta subunit [Neorickettsia ri...
357244	Orientia tsutsugamushi str. Boryong	1 (0.03%)	4E-37	64-224	3-167	160	36	169	ref|YP_001248724.1|	phenylalanyl-tRNA synthetase subunit beta [Orientia tsutsuga...
334380	Orientia tsutsugamushi str. Ikeda	1 (0.03%)	3E-36	64-224	3-168	157	35	170	ref|YP_001937289.1|	phenylalanyl-tRNA synthetase subunit beta [Orientia tsutsuga...
434271	Actinobacillus pleuropneumoniae serovar 3 str. JL03	2 (0.05%)	1E-49	64-226	3-168	202	34	169	ref|YP_001651617.1|	phenylalanyl-tRNA synthetase subunit beta [Actinobacillus pl...
391896	Rickettsia bellii OSU 85-389	1 (0.03%)	2E-42	64-224	3-166	178	34	168	ref|YP_001496235.1|	phenylalanyl-tRNA synthetase subunit beta [Rickettsia bellii...
336407	Rickettsia bellii RML369-C	1 (0.03%)	2E-42	64-224	3-166	178	34	168	ref|YP_537825.1|	phenylalanyl-tRNA synthetase subunit beta [Rickettsia bellii...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	2 (0.05%)	2E-39	9-212	1-196	168	34	205	ref|YP_002284587.1|	putative tRNA binding domain protein [Ureaplasma urealyticum...
95641	Methylomicrobium buryatense	1 (0.03%)	1E-58	64-226	3-168	232	33	169	ref|WP_017840102.1|	phenylalanyl-tRNA synthetase [Methylomicrobium buryatense]
1091494	Methylomicrobium alcaliphilum 20Z	1 (0.03%)	4E-58	64-226	3-168	230	33	169	ref|YP_004916188.1|	phenylalanyl-tRNA synthetase subunit beta [Methylomicrobium ...
738	Haemophilus parasuis	9 (0.24%)	7E-58	64-226	3-168	229	33	169	ref|WP_021115007.1|	phenylalanyl-tRNA synthetase, beta subunit [Haemophilus para...
1138429	Haemophilus parasuis gx033	1 (0.03%)	1E-57	64-226	3-168	229	33	169	ref|WP_010786627.1|	phenylalanyl-tRNA ligase subunit beta [Haemophilus parasuis]...
456298	Haemophilus parasuis 29755	1 (0.03%)	4E-57	64-226	3-168	227	33	169	ref|WP_005710632.1|	phenylalanyl-tRNA synthetase [Haemophilus parasuis] gb|EQA95...
557723	Haemophilus parasuis SH0165	1 (0.03%)	4E-57	64-226	3-168	227	33	169	ref|YP_002475286.1|	phenylalanyl-tRNA synthetase subunit beta [Haemophilus paras...
1117322	Haemophilus parasuis str. Nagasaki	1 (0.03%)	5E-57	64-226	3-168	227	33	169	ref|WP_021109665.1|	phenylalanine--tRNA ligase, beta subunit [Haemophilus parasu...
857087	Methylomonas methanica MC09	1 (0.03%)	7E-57	64-226	3-168	226	33	169	ref|YP_004512631.1|	Phenylalanyl-tRNA synthetase subunit beta [Methylomonas meth...
591023	Actinobacillus minor 202	1 (0.03%)	3E-56	64-226	3-168	224	33	169	ref|WP_005817722.1|	phenylalanyl-tRNA synthetase [Actinobacillus minor] gb|EEF16...