old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 88340 [SSGCID - MygeA.20039.a] [2019-01-18] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] Uncharacterized protein MG449 - BATCH:88256

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
 
MFDISKDFVSIFYRKETLKNCMFGIIGSRSETTLRQQNDKDWSFFVNDANRITGFNFFNIKKSFKKFFLSHRFNEGLNYPSLKIMKRISELLGYDLISLANKVPFVVCEVVSVIPIANTHLKRCKVNTGLTKSLDIVCGANNVRVGMKTVLVQVGGVLPSGTVIKKTKIAGFDSVGMLCSEKELNLKQKNEGIIEINPKIKVGKPFIDVYLNKQHSKWVNTKKRVKLS
tmhmm (0)
------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (6%)
------------------------------------------------------XXXXXXXXXXXXXX----------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (2%)
XXXX--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred
-------EEEEEE-------EEEEEE------EEEEEE---EEEEE-----EEEEEEE-HHHH--HHHH---------HHHHHHHHHHHEE--EEEEEE-----EEEEEEEEEEE-----EEEEEEEE----EEEEE-----EE---EEEEEE--------EEEEE-----EEE--EE--HHH---------EEE----------HHHHH-----EEEEE--------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    52	    0.114
  max. Y    36	    0.140
  max. S    35	    0.308
  mean S     1-35   0.146
       D     1-35   0.142    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.142 D-cutoff=0.450 Networks=SignalP-TM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-228     alignment     2e8gA_310     1-240   0.7346   RNA BINDING PROTEIN


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
662947Mycoplasma genitalium M22881 (0.03%)5E-551-2281-228220100228ref|YP_006599993.1|hypothetical protein CM9_02645 [Mycoplasma genitalium M2321]...
66084Wolbachia sp. wRi1 (0.03%)1E-4164-2243-16217539167ref|YP_002726928.1|Phenylalanyl-tRNA synthetase beta chain [Wolbachia sp. wRi] ...
569881Wolbachia endosymbiont of Culex quinquefasciatus JHB1 (0.03%)9E-4264-2243-16217638167ref|YP_001975391.1|phenylalanyl-tRNA synthetase subunit beta [Wolbachia endosym...
564608Micromonas pusilla CCMP15455 (0.13%)2E-28103-204323-42613238104ref|XP_003055425.1|translation initiation factor [Micromonas pusilla CCMP1545] ...
434131Neorickettsia risticii str. Illinois1 (0.03%)6E-4064-2243-15917036165ref|YP_003081624.1|phenylalanyl-tRNA synthetase, beta subunit [Neorickettsia ri...
357244Orientia tsutsugamushi str. Boryong1 (0.03%)4E-3764-2243-16716036169ref|YP_001248724.1|phenylalanyl-tRNA synthetase subunit beta [Orientia tsutsuga...
334380Orientia tsutsugamushi str. Ikeda1 (0.03%)3E-3664-2243-16815735170ref|YP_001937289.1|phenylalanyl-tRNA synthetase subunit beta [Orientia tsutsuga...
434271Actinobacillus pleuropneumoniae serovar 3 str. JL032 (0.05%)1E-4964-2263-16820234169ref|YP_001651617.1|phenylalanyl-tRNA synthetase subunit beta [Actinobacillus pl...
391896Rickettsia bellii OSU 85-3891 (0.03%)2E-4264-2243-16617834168ref|YP_001496235.1|phenylalanyl-tRNA synthetase subunit beta [Rickettsia bellii...
336407Rickettsia bellii RML369-C1 (0.03%)2E-4264-2243-16617834168ref|YP_537825.1|phenylalanyl-tRNA synthetase subunit beta [Rickettsia bellii...
626096Ureaplasma urealyticum serovar 2 str. ATCC 278142 (0.05%)2E-399-2121-19616834205ref|YP_002284587.1|putative tRNA binding domain protein [Ureaplasma urealyticum...
95641Methylomicrobium buryatense1 (0.03%)1E-5864-2263-16823233169ref|WP_017840102.1|phenylalanyl-tRNA synthetase [Methylomicrobium buryatense]
1091494Methylomicrobium alcaliphilum 20Z1 (0.03%)4E-5864-2263-16823033169ref|YP_004916188.1|phenylalanyl-tRNA synthetase subunit beta [Methylomicrobium ...
738Haemophilus parasuis9 (0.24%)7E-5864-2263-16822933169ref|WP_021115007.1|phenylalanyl-tRNA synthetase, beta subunit [Haemophilus para...
1138429Haemophilus parasuis gx0331 (0.03%)1E-5764-2263-16822933169ref|WP_010786627.1|phenylalanyl-tRNA ligase subunit beta [Haemophilus parasuis]...
456298Haemophilus parasuis 297551 (0.03%)4E-5764-2263-16822733169ref|WP_005710632.1|phenylalanyl-tRNA synthetase [Haemophilus parasuis] gb|EQA95...
557723Haemophilus parasuis SH01651 (0.03%)4E-5764-2263-16822733169ref|YP_002475286.1|phenylalanyl-tRNA synthetase subunit beta [Haemophilus paras...
1117322Haemophilus parasuis str. Nagasaki1 (0.03%)5E-5764-2263-16822733169ref|WP_021109665.1|phenylalanine--tRNA ligase, beta subunit [Haemophilus parasu...
857087Methylomonas methanica MC091 (0.03%)7E-5764-2263-16822633169ref|YP_004512631.1|Phenylalanyl-tRNA synthetase subunit beta [Methylomonas meth...
591023Actinobacillus minor 2021 (0.03%)3E-5664-2263-16822433169ref|WP_005817722.1|phenylalanyl-tRNA synthetase [Actinobacillus minor] gb|EEF16...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington