old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 88345 [SSGCID - MygeA.20057.a] [2019-01-18] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] tRNA(Ile)-lysidine synthase (MG_084) - BATCH:88256

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  
 
MASEKQYIAGVSGGSDSMLMLKLYQKKIACVVHVNYNTRSTSLRDQKLVEQYCQKLNIPLVVHTVDPDLVWKKNFQNQARKIRFDQFKKTAKLYQTNKLLLAHHRDDFIEQAKMQLDAKKRAVYYGIKTRCELYGLKIYRPLMKYWKDEIIALCRQDHIPYEIDETNKLPIYKRNEVRLEIEKWSKIEKEQFYIAICAMNKTIAQKLFVLMKKAKKWLLQPDVRELKRFSIIDQKQLIYSYLIYHKINVNGEKIDAILDFIQPSQQKQYRLQNDIFLMVKNQCLALLYKS
tmhmm (0)
--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)
--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (6%)
XX----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXX-----------------
psipred
-----EEEEEEE--HHHHHHHHHHHH---EEEEEE-------HHHHHHHHHHHHH----EEEE-----------HHHHHHHHHHHHHHHHHHHHH--HH-----HHHHHHHHHHH--------------------------EEEEEHHHHHHHHHH-----------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHH--HHHHHHHHHHHHHH------HHHHHHHHHHHHH----EEEE---EEEEEE--EEEEEE--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C     3	    0.115
  max. Y    32	    0.163
  max. S    27	    0.344
  mean S     1-31   0.140
       D     1-31   0.154    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.154 D-cutoff=0.450 Networks=SignalP-TM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-290     alignment     3a2kA_201     1-462   0.8256   LIGASE/RNA


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
662947Mycoplasma genitalium M22881 (0.03%)2E-671-2901-290262100290ref|NP_072746.1|tRNA(Ile)-lysidine synthetase [Mycoplasma genitalium G37] re...
662946Mycoplasma genitalium M62821 (0.03%)3E-671-2901-290261100290ref|YP_006600099.1|PP-loop superfamily protein ATPase [Mycoplasma genitalium M6...
708616Mycoplasma gallisepticum str. F1 (0.03%)4E-513-2885-28620836286ref|YP_005880983.1|tRNA(Ile)-lysidine synthase [Mycoplasma gallisepticum str. F...
565575Ureaplasma urealyticum serovar 10 str. ATCC 336991 (0.03%)8E-514-28514-30320736290ref|YP_002284496.1|tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serova...
626096Ureaplasma urealyticum serovar 2 str. ATCC 278141 (0.03%)5E-514-28514-30320736290ref|WP_004026004.1|tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum] gb|ED...
515611Ureaplasma urealyticum serovar 13 str. ATCC 336981 (0.03%)1E-504-28514-30320636290ref|WP_004027146.1|tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum] gb|ED...
550748Ureaplasma urealyticum serovar 4 str. ATCC 278161 (0.03%)1E-504-28514-30320636290ref|WP_004026345.1|tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum] gb|ED...
519851Ureaplasma parvum serovar 6 str. ATCC 278181 (0.03%)6E-493-28513-30320136291ref|YP_001752156.1|tRNA(Ile)-lysidine synthetase [Ureaplasma parvum serovar 3 s...
515608Ureaplasma parvum serovar 1 str. ATCC 278131 (0.03%)3E-493-28513-30320136291ref|WP_006689264.1|tRNA(Ile)-lysidine synthetase [Ureaplasma parvum] gb|EDT4904...
262723Mycoplasma synoviae 531 (0.03%)2E-496-2894-28920235289gb|AAZ44022.2|conserved hypothetical protein [Mycoplasma synoviae 53]
45361Mycoplasma conjunctivae1 (0.03%)2E-436-2768-28018234276ref|YP_002960821.1|tRNA(Ile)-lysidine synthase [Mycoplasma conjunctivae HRC/581...
496833Mycoplasma fermentans PG181 (0.03%)6E-508-28914-30420433291ref|YP_007762345.1|hypothetical protein [Mycoplasma fermentans PG18] ref|WP_015...
637387Mycoplasma fermentans JER1 (0.03%)7E-508-28911-30120433291ref|YP_003923310.1|cell cycle protein [Mycoplasma fermentans JER] ref|WP_013355...
747682Mycoplasma alligatoris A21JP21 (0.03%)9E-471-2852-29019333293ref|WP_005683803.1|tRNA(Ile)-lysidine synthetase [Mycoplasma alligatoris] gb|EF...
243272Mycoplasma arthritidis 158L3-11 (0.03%)4E-563-28715-30522432291ref|YP_002000278.1|PP-loop superfamily ATPase/cell cycle protein [Mycoplasma ar...
289397Mycoplasma bovis PG451 (0.03%)3E-537-2862-28621532287ref|YP_004056637.1|tRNA(Ile)-lysidine synthetase [Mycoplasma bovis PG45] ref|WP...
347257Mycoplasma agalactiae PG21 (0.03%)6E-527-2862-28621032287ref|YP_001256884.1|hypothetical protein MAG_7460 [Mycoplasma agalactiae PG2] re...
2110Mycoplasma agalactiae1 (0.03%)2E-517-2862-28620932287ref|YP_003516013.1|hypothetical protein MAGa8640 [Mycoplasma agalactiae] ref|WP...
634997Mycoplasma hyorhinis DBS 10501 (0.03%)4E-464-2866-29219132289ref|YP_003856528.1|tRNA(Ile)-lysidine synthase [Mycoplasma hyorhinis HUB-1] ref...
512564Mycoplasma crocodyli MP1451 (0.03%)6E-476-2865-28919431287ref|YP_003560371.1|tRNA(Ile)-lysidine synthase [Mycoplasma crocodyli MP145] ref...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington