old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 .
	MASEKQYIAGVSGGSDSMLMLKLYQKKIACVVHVNYNTRSTSLRDQKLVEQYCQKLNIPLVVHTVDPDLVWKKNFQNQARKIRFDQFKKTAKLYQTNKLLLAHHRDDFIEQAKMQLDAKKRAVYYGIKTRCELYGLKIYRPLMKYWKDEIIALCRQDHIPYEIDETNKLPIYKRNEVRLEIEKWSKIEKEQFYIAICAMNKTIAQKLFVLMKKAKKWLLQPDVRELKRFSIIDQKQLIYSYLIYHKINVNGEKIDAILDFIQPSQQKQYRLQNDIFLMVKNQCLALLYKS
tmhmm (0)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (6%)	XX----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXX-----------------
psipred	-----EEEEEEE--HHHHHHHHHHHH---EEEEEE-------HHHHHHHHHHHHH----EEEE-----------HHHHHHHHHHHHHHHHHHHHH--HH-----HHHHHHHHHHH--------------------------EEEEEHHHHHHHHHH-----------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHH--HHHHHHHHHHHHHH------HHHHHHHHHHHHH----EEEE---EEEEEE--EEEEEE--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C     3	    0.115
  max. Y    32	    0.163
  max. S    27	    0.344
  mean S     1-31   0.140
       D     1-31   0.154    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.154 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-290	alignment	3a2kA_201	1-462	0.8256	LIGASE/RNA

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	2E-67	1-290	1-290	262	100	290	ref|NP_072746.1|	tRNA(Ile)-lysidine synthetase [Mycoplasma genitalium G37] re...
662946	Mycoplasma genitalium M6282	1 (0.03%)	3E-67	1-290	1-290	261	100	290	ref|YP_006600099.1|	PP-loop superfamily protein ATPase [Mycoplasma genitalium M6...
708616	Mycoplasma gallisepticum str. F	1 (0.03%)	4E-51	3-288	5-286	208	36	286	ref|YP_005880983.1|	tRNA(Ile)-lysidine synthase [Mycoplasma gallisepticum str. F...
565575	Ureaplasma urealyticum serovar 10 str. ATCC 33699	1 (0.03%)	8E-51	4-285	14-303	207	36	290	ref|YP_002284496.1|	tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum serova...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	1 (0.03%)	5E-51	4-285	14-303	207	36	290	ref|WP_004026004.1|	tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum] gb|ED...
515611	Ureaplasma urealyticum serovar 13 str. ATCC 33698	1 (0.03%)	1E-50	4-285	14-303	206	36	290	ref|WP_004027146.1|	tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum] gb|ED...
550748	Ureaplasma urealyticum serovar 4 str. ATCC 27816	1 (0.03%)	1E-50	4-285	14-303	206	36	290	ref|WP_004026345.1|	tRNA(Ile)-lysidine synthetase [Ureaplasma urealyticum] gb|ED...
519851	Ureaplasma parvum serovar 6 str. ATCC 27818	1 (0.03%)	6E-49	3-285	13-303	201	36	291	ref|YP_001752156.1|	tRNA(Ile)-lysidine synthetase [Ureaplasma parvum serovar 3 s...
515608	Ureaplasma parvum serovar 1 str. ATCC 27813	1 (0.03%)	3E-49	3-285	13-303	201	36	291	ref|WP_006689264.1|	tRNA(Ile)-lysidine synthetase [Ureaplasma parvum] gb|EDT4904...
262723	Mycoplasma synoviae 53	1 (0.03%)	2E-49	6-289	4-289	202	35	289	gb|AAZ44022.2|	conserved hypothetical protein [Mycoplasma synoviae 53]
45361	Mycoplasma conjunctivae	1 (0.03%)	2E-43	6-276	8-280	182	34	276	ref|YP_002960821.1|	tRNA(Ile)-lysidine synthase [Mycoplasma conjunctivae HRC/581...
496833	Mycoplasma fermentans PG18	1 (0.03%)	6E-50	8-289	14-304	204	33	291	ref|YP_007762345.1|	hypothetical protein [Mycoplasma fermentans PG18] ref|WP_015...
637387	Mycoplasma fermentans JER	1 (0.03%)	7E-50	8-289	11-301	204	33	291	ref|YP_003923310.1|	cell cycle protein [Mycoplasma fermentans JER] ref|WP_013355...
747682	Mycoplasma alligatoris A21JP2	1 (0.03%)	9E-47	1-285	2-290	193	33	293	ref|WP_005683803.1|	tRNA(Ile)-lysidine synthetase [Mycoplasma alligatoris] gb|EF...
243272	Mycoplasma arthritidis 158L3-1	1 (0.03%)	4E-56	3-287	15-305	224	32	291	ref|YP_002000278.1|	PP-loop superfamily ATPase/cell cycle protein [Mycoplasma ar...
289397	Mycoplasma bovis PG45	1 (0.03%)	3E-53	7-286	2-286	215	32	287	ref|YP_004056637.1|	tRNA(Ile)-lysidine synthetase [Mycoplasma bovis PG45] ref|WP...
347257	Mycoplasma agalactiae PG2	1 (0.03%)	6E-52	7-286	2-286	210	32	287	ref|YP_001256884.1|	hypothetical protein MAG_7460 [Mycoplasma agalactiae PG2] re...
2110	Mycoplasma agalactiae	1 (0.03%)	2E-51	7-286	2-286	209	32	287	ref|YP_003516013.1|	hypothetical protein MAGa8640 [Mycoplasma agalactiae] ref|WP...
634997	Mycoplasma hyorhinis DBS 1050	1 (0.03%)	4E-46	4-286	6-292	191	32	289	ref|YP_003856528.1|	tRNA(Ile)-lysidine synthase [Mycoplasma hyorhinis HUB-1] ref...
512564	Mycoplasma crocodyli MP145	1 (0.03%)	6E-47	6-286	5-289	194	31	287	ref|YP_003560371.1|	tRNA(Ile)-lysidine synthase [Mycoplasma crocodyli MP145] ref...