old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380 . 390 . 400 . 410 . 420 . 430 . 440 .
	MMDKRTSEIEFHLKNLLACDAYKLSHRLMYPQDTQNLYSMLTARGVYGDFKEFVWNHDFAKEILLNVFNGFVNSVIEVKKNKLLAAALTDKLVSVFNDHELANEFTQHICHLASFLEKNKKMPLVAKIHESDQSLPFRTPLITIEGVENIPNNFVWLVNYFETVLLENIWLFQTASTVAKRIKSLLEKYAKETADETSFINFQCHDFSMRGMSSLQSALYVARAHLQYFTGSDTILGGDNSRSILASEHSVMCADGSKHELKTFQRLLEKFKDKKLSLVIDSYDMWNVLDNIIPRLKNLILMRGATLYLRADSGNYQTLICNPNYKKQDKSTWAMIDYLDHHFSSTINKKGYKVLNKKIGIIYGDGITYQKIEWILNCLKNHGYCSSNIIFGVGSSTYQNLNRDTLGFVYKLTAIKRNNRWIGVKKTPITDLSKSSKGGRYKTKRLITVY
tmhmm (0)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (5%)	XXXXXXXXXX------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXX------------
psipred	---------------HHH----HHHHHH----HHHHHHHHHH--------EEEEEE-----HHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHH----HHHHHHHHHHHHHHHH-----EEEEE-----EE-----EEEEEE-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HH-----------HHHHHHHHHHHH-----HHHHHHHH-------HHHHHHHHH---HHHHHHHHHHHH----EEEEEEE---HHHHHHHHHHHHHHHHH-----EEEE-----HHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHH-----EEEEE-----HHHHHHHHHHHHH-------EEEE--HHHH---------EEEEEEEEEE--EEEEEEE-------------EEEEEEE----

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    49	    0.115
  max. Y     2	    0.148
  max. S     1	    0.223
  mean S     1-1    0.223
       D     1-1    0.178    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.178 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-450	alignment	6b76D_202	1-471	0.8057	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
488339	synthetic Mycoplasma genitalium JCVI-1.0	1 (0.03%)	1E-126	1-450	1-450	459	100	450	ref|NP_072697.1|	nicotinate phosphoribosyltransferase [Mycoplasma genitalium ...
2097	Mycoplasma genitalium	1 (0.03%)	1E-114	29-450	1-422	420	100	422	ref|WP_009885701.1|	nicotinate phosphoribosyltransferase [Mycoplasma genitalium]
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	1E-118	2-450	1-450	430	67	450	ref|NP_109735.1|	nicotinate phosphoribosyltransferase [Mycoplasma pneumoniae ...
2096	Mycoplasma gallisepticum	1 (0.03%)	1E-103	6-450	11-462	382	52	452	gb|AAN64191.1|	unknown [Mycoplasma gallisepticum]
1006581	Mycoplasma gallisepticum S6	1 (0.03%)	1E-102	6-450	11-462	380	52	452	ref|YP_008894540.1|	nicotinate phosphoribosyltransferase [Mycoplasma galliseptic...
1159204	Mycoplasma gallisepticum NC08_2008.031-4-3P	1 (0.03%)	1E-103	6-450	11-462	380	52	452	ref|YP_006581514.1|	esterase/lipase [Mycoplasma gallisepticum VA94_7994-1-7P] re...
708616	Mycoplasma gallisepticum str. F	1 (0.03%)	1E-102	6-450	11-462	378	52	452	ref|NP_853399.2|	putative nicotinate phosphoribosyltransferase [Mycoplasma ga...
754261	Actinobacillus pleuropneumoniae serovar 12 str. 1096	1 (0.03%)	2E-43	293-443	3-156	183	44	154	ref|WP_005614895.1|	nicotinate phosphoribosyltransferase [Actinobacillus pleurop...
754262	Actinobacillus pleuropneumoniae serovar 13 str. N273	1 (0.03%)	4E-43	293-443	3-156	182	44	154	ref|WP_005611893.1|	nicotinate phosphoribosyltransferase [Actinobacillus pleurop...
537457	Actinobacillus pleuropneumoniae serovar 7 str. AP76	1 (0.03%)	7E-41	304-443	6-146	175	44	141	ref|YP_001968482.1|	hypothetical protein APP7_0688 [Actinobacillus pleuropneumon...
754256	Actinobacillus pleuropneumoniae serovar 6 str. Femo	1 (0.03%)	3E-9	393-443	1-52	70	44	52	ref|WP_005600796.1|	nicotinate phosphoribosyltransferase [Actinobacillus pleurop...
754255	Actinobacillus pleuropneumoniae serovar 4 str. M62	1 (0.03%)	1E-41	293-443	3-156	177	43	154	ref|WP_005604051.1|	nicotinate phosphoribosyltransferase [Actinobacillus pleurop...
228399	Actinobacillus pleuropneumoniae serovar 1 str. 4074	1 (0.03%)	3E-40	293-443	3-155	172	42	154	ref|WP_005596935.1|	nicotinate phosphoribosyltransferase [Actinobacillus pleurop...
754260	Actinobacillus pleuropneumoniae serovar 11 str. 56153	1 (0.03%)	2E-39	293-443	3-155	170	42	154	ref|WP_005609961.1|	nicotinate phosphoribosyltransferase [Actinobacillus pleurop...
696748	Actinobacillus suis H91-0380	1 (0.03%)	1E-116	15-444	15-446	425	36	448	ref|YP_006817140.1|	nicotinate phosphoribosyltransferase [Actinobacillus suis H9...
717	Actinobacillus capsulatus	1 (0.03%)	1E-116	15-443	15-445	424	36	447	ref|WP_018650946.1|	nicotinate phosphoribosyltransferase [Actinobacillus capsula...
887324	Actinobacillus ureae ATCC 25976	1 (0.03%)	1E-115	15-443	2-432	423	36	447	ref|WP_005622841.1|	nicotinate phosphoribosyltransferase [Actinobacillus ureae] ...
1329902	Mannheimia haemolytica MhBrain2012	1 (0.03%)	1E-115	15-444	15-446	421	36	448	ref|YP_007665895.1|	Nicotinamide phosphoribosyl transferase [Mannheimia haemolyt...
758	Pasteurella pneumotropica	1 (0.03%)	1E-115	15-443	15-445	421	36	447	ref|WP_018355561.1|	nicotinate phosphoribosyltransferase [Pasteurella pneumotrop...
1311759	Mannheimia haemolytica D171	1 (0.03%)	1E-115	15-444	15-446	421	36	448	ref|YP_008219217.1|	nicotinate phosphoribosyltransferase [Mannheimia haemolytica...