| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380 . 390 . 400 . 410 . 420 . 430 . 440 . |
| | MMDKRTSEIEFHLKNLLACDAYKLSHRLMYPQDTQNLYSMLTARGVYGDFKEFVWNHDFAKEILLNVFNGFVNSVIEVKKNKLLAAALTDKLVSVFNDHELANEFTQHICHLASFLEKNKKMPLVAKIHESDQSLPFRTPLITIEGVENIPNNFVWLVNYFETVLLENIWLFQTASTVAKRIKSLLEKYAKETADETSFINFQCHDFSMRGMSSLQSALYVARAHLQYFTGSDTILGGDNSRSILASEHSVMCADGSKHELKTFQRLLEKFKDKKLSLVIDSYDMWNVLDNIIPRLKNLILMRGATLYLRADSGNYQTLICNPNYKKQDKSTWAMIDYLDHHFSSTINKKGYKVLNKKIGIIYGDGITYQKIEWILNCLKNHGYCSSNIIFGVGSSTYQNLNRDTLGFVYKLTAIKRNNRWIGVKKTPITDLSKSSKGGRYKTKRLITVY |
| tmhmm (0) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| low complexity (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| coiled-coils (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| disordered (5%) | XXXXXXXXXX------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXX------------ |
| psipred | ---------------HHH----HHHHHH----HHHHHHHHHH--------EEEEEE-----HHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHH----HHHHHHHHHHHHHHHH-----EEEEE-----EE-----EEEEEE-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HH-----------HHHHHHHHHHHH-----HHHHHHHH-------HHHHHHHHH---HHHHHHHHHHHH----EEEEEEE---HHHHHHHHHHHHHHHHH-----EEEE-----HHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHH-----EEEEE-----HHHHHHHHHHHHH-------EEEE--HHHH---------EEEEEEEEEE--EEEEEEE-------------EEEEEEE---- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 488339 | synthetic Mycoplasma genitalium JCVI-1.0 | 1 (0.03%) | 1E-126 | 1-450 | 1-450 | 459 | 100 | 450 | ref|NP_072697.1| | nicotinate phosphoribosyltransferase [Mycoplasma genitalium ... |
| 2097 | Mycoplasma genitalium | 1 (0.03%) | 1E-114 | 29-450 | 1-422 | 420 | 100 | 422 | ref|WP_009885701.1| | nicotinate phosphoribosyltransferase [Mycoplasma genitalium] |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.03%) | 1E-118 | 2-450 | 1-450 | 430 | 67 | 450 | ref|NP_109735.1| | nicotinate phosphoribosyltransferase [Mycoplasma pneumoniae ... |
| 2096 | Mycoplasma gallisepticum | 1 (0.03%) | 1E-103 | 6-450 | 11-462 | 382 | 52 | 452 | gb|AAN64191.1| | unknown [Mycoplasma gallisepticum] |
| 1006581 | Mycoplasma gallisepticum S6 | 1 (0.03%) | 1E-102 | 6-450 | 11-462 | 380 | 52 | 452 | ref|YP_008894540.1| | nicotinate phosphoribosyltransferase [Mycoplasma galliseptic... |
| 1159204 | Mycoplasma gallisepticum NC08_2008.031-4-3P | 1 (0.03%) | 1E-103 | 6-450 | 11-462 | 380 | 52 | 452 | ref|YP_006581514.1| | esterase/lipase [Mycoplasma gallisepticum VA94_7994-1-7P] re... |
| 708616 | Mycoplasma gallisepticum str. F | 1 (0.03%) | 1E-102 | 6-450 | 11-462 | 378 | 52 | 452 | ref|NP_853399.2| | putative nicotinate phosphoribosyltransferase [Mycoplasma ga... |
| 754261 | Actinobacillus pleuropneumoniae serovar 12 str. 1096 | 1 (0.03%) | 2E-43 | 293-443 | 3-156 | 183 | 44 | 154 | ref|WP_005614895.1| | nicotinate phosphoribosyltransferase [Actinobacillus pleurop... |
| 754262 | Actinobacillus pleuropneumoniae serovar 13 str. N273 | 1 (0.03%) | 4E-43 | 293-443 | 3-156 | 182 | 44 | 154 | ref|WP_005611893.1| | nicotinate phosphoribosyltransferase [Actinobacillus pleurop... |
| 537457 | Actinobacillus pleuropneumoniae serovar 7 str. AP76 | 1 (0.03%) | 7E-41 | 304-443 | 6-146 | 175 | 44 | 141 | ref|YP_001968482.1| | hypothetical protein APP7_0688 [Actinobacillus pleuropneumon... |
| 754256 | Actinobacillus pleuropneumoniae serovar 6 str. Femo | 1 (0.03%) | 3E-9 | 393-443 | 1-52 | 70 | 44 | 52 | ref|WP_005600796.1| | nicotinate phosphoribosyltransferase [Actinobacillus pleurop... |
| 754255 | Actinobacillus pleuropneumoniae serovar 4 str. M62 | 1 (0.03%) | 1E-41 | 293-443 | 3-156 | 177 | 43 | 154 | ref|WP_005604051.1| | nicotinate phosphoribosyltransferase [Actinobacillus pleurop... |
| 228399 | Actinobacillus pleuropneumoniae serovar 1 str. 4074 | 1 (0.03%) | 3E-40 | 293-443 | 3-155 | 172 | 42 | 154 | ref|WP_005596935.1| | nicotinate phosphoribosyltransferase [Actinobacillus pleurop... |
| 754260 | Actinobacillus pleuropneumoniae serovar 11 str. 56153 | 1 (0.03%) | 2E-39 | 293-443 | 3-155 | 170 | 42 | 154 | ref|WP_005609961.1| | nicotinate phosphoribosyltransferase [Actinobacillus pleurop... |
| 696748 | Actinobacillus suis H91-0380 | 1 (0.03%) | 1E-116 | 15-444 | 15-446 | 425 | 36 | 448 | ref|YP_006817140.1| | nicotinate phosphoribosyltransferase [Actinobacillus suis H9... |
| 717 | Actinobacillus capsulatus | 1 (0.03%) | 1E-116 | 15-443 | 15-445 | 424 | 36 | 447 | ref|WP_018650946.1| | nicotinate phosphoribosyltransferase [Actinobacillus capsula... |
| 887324 | Actinobacillus ureae ATCC 25976 | 1 (0.03%) | 1E-115 | 15-443 | 2-432 | 423 | 36 | 447 | ref|WP_005622841.1| | nicotinate phosphoribosyltransferase [Actinobacillus ureae] ... |
| 1329902 | Mannheimia haemolytica MhBrain2012 | 1 (0.03%) | 1E-115 | 15-444 | 15-446 | 421 | 36 | 448 | ref|YP_007665895.1| | Nicotinamide phosphoribosyl transferase [Mannheimia haemolyt... |
| 758 | Pasteurella pneumotropica | 1 (0.03%) | 1E-115 | 15-443 | 15-445 | 421 | 36 | 447 | ref|WP_018355561.1| | nicotinate phosphoribosyltransferase [Pasteurella pneumotrop... |
| 1311759 | Mannheimia haemolytica D171 | 1 (0.03%) | 1E-115 | 15-444 | 15-446 | 421 | 36 | 448 | ref|YP_008219217.1| | nicotinate phosphoribosyltransferase [Mannheimia haemolytica... |