| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . |
| | MTFSTQIKAELVQNKLIDKHWNVFLAGFFQNNLKLLYNRNWSFKVQSEALKEQFVQNLKFDFKTKASKKYFLFEFNADINVINTLLKLDVTTSELVVKQVYLIAAFLSGGSVSDLINSNNFHLQISSNNEFQIQQLLKLFSFFKKTVKQNQLVVYLKSYEKICNFLKLIQAFDGYLAFENKQLEKSFTLNQLRKSNLEVANLMKTIRSNNQTNQLQLKSFIKSSSFAKRPLNFQRYCLIKSDHPDWSLEQIANFFFTKYNIKISRSGIQHFSVNLKKLCQ |
| tmhmm (0) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (0%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X |
| psipred | ---HHHHHHHHH------HHHHHHHHHHHHH---EEE--EEEEEEEHHHHHHHHHHHHHHHH----EEEEEEEE---HHHHHHH--------HHHHHHHHHHHHHHH--EE----------EEEEE---HHHHHHHHHHHHHHHHHHH---EEEEEE-HHHHHHHHHHH--HHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHH-----HHHHHHHHH--------HHHHHHHHHHHHHHH- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.05%) | 5E-55 | 1-280 | 1-280 | 220 | 100 | 280 | ref|NP_072765.1| | hypothetical protein MG_103 [Mycoplasma genitalium G37] ref|... |
| 936154 | Streptococcus parauberis KCTC 11537 | 2 (0.11%) | 3E-49 | 94-280 | 3-187 | 201 | 29 | 191 | ref|YP_004478556.1| | hypothetical protein STP_0436, partial [Streptococcus paraub... |
| 272633 | Mycoplasma penetrans HF-2 | 1 (0.05%) | 2E-48 | 1-280 | 1-300 | 199 | 28 | 303 | ref|NP_757568.1| | hypothetical protein MYPE1810 [Mycoplasma penetrans HF-2] re... |
| 1048830 | Mycoplasma iowae 695 | 1 (0.05%) | 8E-52 | 1-280 | 3-302 | 210 | 27 | 301 | ref|WP_004024887.1| | hypothetical protein [Mycoplasma iowae] gb|EGZ31416.1| hypot... |
| 944565 | Parvimonas sp. oral taxon 393 str. F0440 | 4 (0.22%) | 3E-8 | 161-222 | 1-62 | 66 | 27 | 62 | ref|WP_009449026.1| | hypothetical protein [Parvimonas sp. oral taxon 393] gb|EGV0... |
| 904321 | Staphylococcus epidermidis VCU045 | 1 (0.05%) | 2E-60 | 73-279 | 4-213 | 239 | 26 | 216 | ref|WP_002468695.1| | sporulation protein [Staphylococcus epidermidis] gb|EGG59884... |
| 1193576 | Staphylococcus aureus subsp. aureus CN1 | 2 (0.11%) | 1E-58 | 73-279 | 4-213 | 233 | 26 | 216 | ref|YP_005297201.1| | cytoplasmic hypothetical protein [Staphylococcus aureus subs... |
| 565575 | Ureaplasma urealyticum serovar 10 str. ATCC 33699 | 1 (0.05%) | 6E-44 | 2-280 | 18-319 | 184 | 26 | 304 | ref|YP_002284492.1| | hypothetical protein UUR10_0079 [Ureaplasma urealyticum sero... |
| 626096 | Ureaplasma urealyticum serovar 2 str. ATCC 27814 | 1 (0.05%) | 5E-44 | 2-280 | 18-319 | 184 | 26 | 304 | ref|WP_004025645.1| | hypothetical protein [Ureaplasma urealyticum] gb|EDU06456.1|... |
| 767100 | Parvimonas sp. oral taxon 110 str. F0139 | 2 (0.11%) | 1E-24 | 161-274 | 1-107 | 119 | 26 | 114 | ref|WP_009355003.1| | hypothetical protein [Parvimonas sp. oral taxon 110] gb|EGL3... |
| 883110 | Facklamia hominis ACS-120-V-Sch10 | 1 (0.05%) | 4E-78 | 1-280 | 1-304 | 297 | 25 | 310 | ref|WP_006908458.1| | sporulation regulator WhiA [Facklamia hominis] gb|EKB54961.1... |
| 1221538 | Lactobacillus florum 8D | 1 (0.05%) | 2E-74 | 1-280 | 1-304 | 285 | 25 | 310 | ref|WP_009166934.1| | sporulation regulator WhiA [Lactobacillus florum] gb|EKK2052... |
| 457402 | Eubacterium sp. 3_1_31 | 1 (0.05%) | 9E-71 | 1-279 | 1-306 | 273 | 25 | 309 | ref|WP_008690584.1| | hypothetical protein [Firmicutes] gb|EFE48038.1| hypothetica... |
| 1631 | Fructobacillus fructosus | 1 (0.05%) | 7E-70 | 1-280 | 1-301 | 270 | 25 | 308 | ref|WP_010690601.1| | sporulation regulator WhiA [Fructobacillus fructosus] |
| 525280 | Erysipelothrix rhusiopathiae ATCC 19414 | 1 (0.05%) | 2E-67 | 1-279 | 1-306 | 262 | 25 | 308 | ref|WP_003774454.1| | hypothetical protein [Erysipelothrix rhusiopathiae] gb|EFY08... |
| 650150 | Erysipelothrix rhusiopathiae str. Fujisawa | 1 (0.05%) | 3E-67 | 1-279 | 1-306 | 261 | 25 | 308 | ref|YP_004561632.1| | hypothetical protein ERH_1538 [Erysipelothrix rhusiopathiae ... |
| 38402 | Erysipelothrix tonsillarum | 1 (0.05%) | 1E-66 | 1-279 | 1-306 | 259 | 25 | 308 | ref|WP_018580235.1| | hypothetical protein [Erysipelothrix tonsillarum] |
| 471875 | Ruminococcus lactaris ATCC 29176 | 2 (0.11%) | 5E-61 | 90-279 | 34-220 | 240 | 25 | 195 | ref|WP_005611014.1| | hypothetical protein [Ruminococcus lactaris] gb|EDY32765.1| ... |
| 904791 | Staphylococcus epidermidis IS-K | 2 (0.11%) | 3E-60 | 73-279 | 4-213 | 238 | 25 | 216 | ref|WP_001832611.1| | sporulation protein [Staphylococcus epidermidis] gb|EID39501... |
| 1151368 | Clostridium difficile F314 | 1 (0.05%) | 2E-57 | 77-279 | 20-219 | 229 | 25 | 208 | ref|WP_009903741.1| | sporulation protein [[Clostridium] difficile] gb|EQH97607.1|... |