old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 88353 [SSGCID - MygeA.20093.a] [2019-01-18] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] Uncharacterized protein MG103 (MG_103) - BATCH:88256

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  
 
MTFSTQIKAELVQNKLIDKHWNVFLAGFFQNNLKLLYNRNWSFKVQSEALKEQFVQNLKFDFKTKASKKYFLFEFNADINVINTLLKLDVTTSELVVKQVYLIAAFLSGGSVSDLINSNNFHLQISSNNEFQIQQLLKLFSFFKKTVKQNQLVVYLKSYEKICNFLKLIQAFDGYLAFENKQLEKSFTLNQLRKSNLEVANLMKTIRSNNQTNQLQLKSFIKSSSFAKRPLNFQRYCLIKSDHPDWSLEQIANFFFTKYNIKISRSGIQHFSVNLKKLCQ
tmhmm (0)
----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)
----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (0%)
---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X
psipred
---HHHHHHHHH------HHHHHHHHHHHHH---EEE--EEEEEEEHHHHHHHHHHHHHHHH----EEEEEEEE---HHHHHHH--------HHHHHHHHHHHHHHH--EE----------EEEEE---HHHHHHHHHHHHHHHHHHH---EEEEEE-HHHHHHHHHHH--HHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHH-----HHHHHHHHH--------HHHHHHHHHHHHHHH-

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    26	    0.109
  max. Y    20	    0.130
  max. S    11	    0.217
  mean S     1-19   0.155
       D     1-19   0.140    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.140 D-cutoff=0.450 Networks=SignalP-TM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
  168     2.62     166,172,167  


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-280     alignment     3hyiA_201     1-284   0.8997   TRANSCRIPTION REGULATOR


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
662947Mycoplasma genitalium M22881 (0.05%)5E-551-2801-280220100280ref|NP_072765.1|hypothetical protein MG_103 [Mycoplasma genitalium G37] ref|...
936154Streptococcus parauberis KCTC 115372 (0.11%)3E-4994-2803-18720129191ref|YP_004478556.1|hypothetical protein STP_0436, partial [Streptococcus paraub...
272633Mycoplasma penetrans HF-21 (0.05%)2E-481-2801-30019928303ref|NP_757568.1|hypothetical protein MYPE1810 [Mycoplasma penetrans HF-2] re...
1048830Mycoplasma iowae 6951 (0.05%)8E-521-2803-30221027301ref|WP_004024887.1|hypothetical protein [Mycoplasma iowae] gb|EGZ31416.1| hypot...
944565Parvimonas sp. oral taxon 393 str. F04404 (0.22%)3E-8161-2221-62662762ref|WP_009449026.1|hypothetical protein [Parvimonas sp. oral taxon 393] gb|EGV0...
904321Staphylococcus epidermidis VCU0451 (0.05%)2E-6073-2794-21323926216ref|WP_002468695.1|sporulation protein [Staphylococcus epidermidis] gb|EGG59884...
1193576Staphylococcus aureus subsp. aureus CN12 (0.11%)1E-5873-2794-21323326216ref|YP_005297201.1|cytoplasmic hypothetical protein [Staphylococcus aureus subs...
565575Ureaplasma urealyticum serovar 10 str. ATCC 336991 (0.05%)6E-442-28018-31918426304ref|YP_002284492.1|hypothetical protein UUR10_0079 [Ureaplasma urealyticum sero...
626096Ureaplasma urealyticum serovar 2 str. ATCC 278141 (0.05%)5E-442-28018-31918426304ref|WP_004025645.1|hypothetical protein [Ureaplasma urealyticum] gb|EDU06456.1|...
767100Parvimonas sp. oral taxon 110 str. F01392 (0.11%)1E-24161-2741-10711926114ref|WP_009355003.1|hypothetical protein [Parvimonas sp. oral taxon 110] gb|EGL3...
883110Facklamia hominis ACS-120-V-Sch101 (0.05%)4E-781-2801-30429725310ref|WP_006908458.1|sporulation regulator WhiA [Facklamia hominis] gb|EKB54961.1...
1221538Lactobacillus florum 8D1 (0.05%)2E-741-2801-30428525310ref|WP_009166934.1|sporulation regulator WhiA [Lactobacillus florum] gb|EKK2052...
457402Eubacterium sp. 3_1_311 (0.05%)9E-711-2791-30627325309ref|WP_008690584.1|hypothetical protein [Firmicutes] gb|EFE48038.1| hypothetica...
1631Fructobacillus fructosus1 (0.05%)7E-701-2801-30127025308ref|WP_010690601.1|sporulation regulator WhiA [Fructobacillus fructosus]
525280Erysipelothrix rhusiopathiae ATCC 194141 (0.05%)2E-671-2791-30626225308ref|WP_003774454.1|hypothetical protein [Erysipelothrix rhusiopathiae] gb|EFY08...
650150Erysipelothrix rhusiopathiae str. Fujisawa1 (0.05%)3E-671-2791-30626125308ref|YP_004561632.1|hypothetical protein ERH_1538 [Erysipelothrix rhusiopathiae ...
38402Erysipelothrix tonsillarum1 (0.05%)1E-661-2791-30625925308ref|WP_018580235.1|hypothetical protein [Erysipelothrix tonsillarum]
471875Ruminococcus lactaris ATCC 291762 (0.11%)5E-6190-27934-22024025195ref|WP_005611014.1|hypothetical protein [Ruminococcus lactaris] gb|EDY32765.1| ...
904791Staphylococcus epidermidis IS-K2 (0.11%)3E-6073-2794-21323825216ref|WP_001832611.1|sporulation protein [Staphylococcus epidermidis] gb|EID39501...
1151368Clostridium difficile F3141 (0.05%)2E-5777-27920-21922925208ref|WP_009903741.1|sporulation protein [[Clostridium] difficile] gb|EQH97607.1|...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington