old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 .
	MTFSTQIKAELVQNKLIDKHWNVFLAGFFQNNLKLLYNRNWSFKVQSEALKEQFVQNLKFDFKTKASKKYFLFEFNADINVINTLLKLDVTTSELVVKQVYLIAAFLSGGSVSDLINSNNFHLQISSNNEFQIQQLLKLFSFFKKTVKQNQLVVYLKSYEKICNFLKLIQAFDGYLAFENKQLEKSFTLNQLRKSNLEVANLMKTIRSNNQTNQLQLKSFIKSSSFAKRPLNFQRYCLIKSDHPDWSLEQIANFFFTKYNIKISRSGIQHFSVNLKKLCQ
tmhmm (0)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (0%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X
psipred	---HHHHHHHHH------HHHHHHHHHHHHH---EEE--EEEEEEEHHHHHHHHHHHHHHHH----EEEEEEEE---HHHHHHH--------HHHHHHHHHHHHHHH--EE----------EEEEE---HHHHHHHHHHHHHHHHHHH---EEEEEE-HHHHHHHHHHH--HHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHH-----HHHHHHHHH--------HHHHHHHHHHHHHHH-

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    26	    0.109
  max. Y    20	    0.130
  max. S    11	    0.217
  mean S     1-19   0.155
       D     1-19   0.140    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.140 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
168	2.62	166,172,167

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-280	alignment	3hyiA_201	1-284	0.8997	TRANSCRIPTION REGULATOR

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.05%)	5E-55	1-280	1-280	220	100	280	ref|NP_072765.1|	hypothetical protein MG_103 [Mycoplasma genitalium G37] ref|...
936154	Streptococcus parauberis KCTC 11537	2 (0.11%)	3E-49	94-280	3-187	201	29	191	ref|YP_004478556.1|	hypothetical protein STP_0436, partial [Streptococcus paraub...
272633	Mycoplasma penetrans HF-2	1 (0.05%)	2E-48	1-280	1-300	199	28	303	ref|NP_757568.1|	hypothetical protein MYPE1810 [Mycoplasma penetrans HF-2] re...
1048830	Mycoplasma iowae 695	1 (0.05%)	8E-52	1-280	3-302	210	27	301	ref|WP_004024887.1|	hypothetical protein [Mycoplasma iowae] gb|EGZ31416.1| hypot...
944565	Parvimonas sp. oral taxon 393 str. F0440	4 (0.22%)	3E-8	161-222	1-62	66	27	62	ref|WP_009449026.1|	hypothetical protein [Parvimonas sp. oral taxon 393] gb|EGV0...
904321	Staphylococcus epidermidis VCU045	1 (0.05%)	2E-60	73-279	4-213	239	26	216	ref|WP_002468695.1|	sporulation protein [Staphylococcus epidermidis] gb|EGG59884...
1193576	Staphylococcus aureus subsp. aureus CN1	2 (0.11%)	1E-58	73-279	4-213	233	26	216	ref|YP_005297201.1|	cytoplasmic hypothetical protein [Staphylococcus aureus subs...
565575	Ureaplasma urealyticum serovar 10 str. ATCC 33699	1 (0.05%)	6E-44	2-280	18-319	184	26	304	ref|YP_002284492.1|	hypothetical protein UUR10_0079 [Ureaplasma urealyticum sero...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	1 (0.05%)	5E-44	2-280	18-319	184	26	304	ref|WP_004025645.1|	hypothetical protein [Ureaplasma urealyticum] gb|EDU06456.1|...
767100	Parvimonas sp. oral taxon 110 str. F0139	2 (0.11%)	1E-24	161-274	1-107	119	26	114	ref|WP_009355003.1|	hypothetical protein [Parvimonas sp. oral taxon 110] gb|EGL3...
883110	Facklamia hominis ACS-120-V-Sch10	1 (0.05%)	4E-78	1-280	1-304	297	25	310	ref|WP_006908458.1|	sporulation regulator WhiA [Facklamia hominis] gb|EKB54961.1...
1221538	Lactobacillus florum 8D	1 (0.05%)	2E-74	1-280	1-304	285	25	310	ref|WP_009166934.1|	sporulation regulator WhiA [Lactobacillus florum] gb|EKK2052...
457402	Eubacterium sp. 3_1_31	1 (0.05%)	9E-71	1-279	1-306	273	25	309	ref|WP_008690584.1|	hypothetical protein [Firmicutes] gb|EFE48038.1| hypothetica...
1631	Fructobacillus fructosus	1 (0.05%)	7E-70	1-280	1-301	270	25	308	ref|WP_010690601.1|	sporulation regulator WhiA [Fructobacillus fructosus]
525280	Erysipelothrix rhusiopathiae ATCC 19414	1 (0.05%)	2E-67	1-279	1-306	262	25	308	ref|WP_003774454.1|	hypothetical protein [Erysipelothrix rhusiopathiae] gb|EFY08...
650150	Erysipelothrix rhusiopathiae str. Fujisawa	1 (0.05%)	3E-67	1-279	1-306	261	25	308	ref|YP_004561632.1|	hypothetical protein ERH_1538 [Erysipelothrix rhusiopathiae ...
38402	Erysipelothrix tonsillarum	1 (0.05%)	1E-66	1-279	1-306	259	25	308	ref|WP_018580235.1|	hypothetical protein [Erysipelothrix tonsillarum]
471875	Ruminococcus lactaris ATCC 29176	2 (0.11%)	5E-61	90-279	34-220	240	25	195	ref|WP_005611014.1|	hypothetical protein [Ruminococcus lactaris] gb|EDY32765.1| ...
904791	Staphylococcus epidermidis IS-K	2 (0.11%)	3E-60	73-279	4-213	238	25	216	ref|WP_001832611.1|	sporulation protein [Staphylococcus epidermidis] gb|EID39501...
1151368	Clostridium difficile F314	1 (0.05%)	2E-57	77-279	20-219	229	25	208	ref|WP_009903741.1|	sporulation protein [[Clostridium] difficile] gb|EQH97607.1|...