| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . |
| | MDLKKAVAFLCEKLQVVETDIFKIEQIHSGFTNFSFFCELKDHSKFQIRLSRKDVILDRRNEQIILQLVEPFFSNPFVYFDVTTGNAIKRWIEGTQPKRATDLFLCRLVESLKKVHSVDWKPFANELLIFDPLVYFEKTKLSAFYKRLYLNLTKKHIDIPKTLCHHDATFDNLVWTPKKQVILIDFEWSCVDNPYYEIANIIREELTIETANKLIDIYGGLKRKLVFETVIYVLLFAFQWTEIMPQTEAILNYRKWVEKRLEYFLKALFPSIWKQAQKNS |
| tmhmm (0) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (2%) | XX-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXX |
| psipred | --HHHHHHHHHHH----HHH-EEEEEE---EE--EEEEEE---EEEEEE---------HHHHHHHHHHHH------EEEEE-----EEEEE-----------HHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----EEEE--------EEEE----EEEE---------HHHHHHHHHHHH--HHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.03%) | 4E-67 | 1-280 | 1-280 | 261 | 100 | 280 | ref|NP_073027.1| | choline/ethanolamine kinase, [Mycoplasma genitalium G37] ref... |
| 1112856 | Mycoplasma pneumoniae 309 | 1 (0.03%) | 5E-61 | 1-277 | 1-277 | 240 | 75 | 277 | ref|YP_005175774.1| | putative choline kinase [Mycoplasma pneumoniae 309] ref|YP_0... |
| 272634 | Mycoplasma pneumoniae M129 | 1 (0.03%) | 1E-60 | 1-277 | 1-277 | 239 | 75 | 277 | ref|NP_110221.1| | choline kinase [Mycoplasma pneumoniae M129] ref|WP_010874889... |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.03%) | 2E-60 | 1-277 | 1-277 | 238 | 75 | 277 | ref|YP_007348105.1| | Thiamine kinase [Mycoplasma pneumoniae M129-B7] ref|WP_01534... |
| 708616 | Mycoplasma gallisepticum str. F | 1 (0.03%) | 5E-49 | 1-272 | 3-271 | 200 | 38 | 274 | ref|YP_005880470.1| | putative choline kinase [Mycoplasma gallisepticum str. F] re... |
| 710128 | Mycoplasma gallisepticum str. R(high) | 1 (0.03%) | 3E-48 | 1-272 | 1-269 | 198 | 38 | 274 | ref|NP_852960.2| | putative choline kinase [Mycoplasma gallisepticum str. R(low... |
| 1159204 | Mycoplasma gallisepticum NC08_2008.031-4-3P | 1 (0.03%) | 1E-47 | 1-272 | 1-269 | 196 | 38 | 274 | ref|YP_006581074.1| | choline kinase [Mycoplasma gallisepticum VA94_7994-1-7P] ref... |
| 1006581 | Mycoplasma gallisepticum S6 | 1 (0.03%) | 2E-47 | 1-272 | 1-269 | 195 | 38 | 274 | ref|YP_008894115.1| | choline kinase [Mycoplasma gallisepticum S6] ref|WP_01188393... |
| 1048830 | Mycoplasma iowae 695 | 1 (0.03%) | 2E-32 | 1-266 | 1-267 | 145 | 33 | 272 | ref|WP_004024853.1| | choline kinase [Mycoplasma iowae] gb|EGZ31382.1| choline kin... |
| 272633 | Mycoplasma penetrans HF-2 | 2 (0.06%) | 6E-37 | 4-269 | 13-278 | 160 | 27 | 272 | ref|NP_757701.1| | choline kinase [Mycoplasma penetrans HF-2] ref|WP_011077141.... |
| 984991 | Mycoplasma parvum | 1 (0.03%) | 1E-32 | 1-266 | 1-272 | 146 | 27 | 275 | ref|YP_008679902.1| | choline kinase [Mycoplasma parvum str. Indiana] ref|WP_02276... |
| 1212765 | Candidatus Mycoplasma haemolamae str. Purdue | 1 (0.03%) | 7E-34 | 1-265 | 1-271 | 150 | 26 | 274 | ref|YP_006530112.1| | putative choline kinase [Candidatus Mycoplasma haemolamae st... |
| 768700 | Mycoplasma suis str. Illinois | 1 (0.03%) | 1E-35 | 1-266 | 1-272 | 156 | 25 | 275 | ref|YP_004250407.1| | choline kinase [Mycoplasma suis str. Illinois] ref|YP_004249... |
| 1116213 | Candidatus Mycoplasma haemominutum 'Birmingham 1' | 1 (0.03%) | 7E-34 | 1-264 | 1-269 | 150 | 25 | 272 | ref|YP_007766432.1| | choline kinase [Candidatus Mycoplasma haemominutum 'Birmingh... |
| 1111676 | Mycoplasma haemocanis str. Illinois | 1 (0.03%) | 2E-39 | 5-272 | 2-266 | 169 | 24 | 273 | ref|YP_005065212.1| | choline kinase [Mycoplasma haemocanis str. Illinois] ref|WP_... |
| 941640 | Mycoplasma haemofelis str. Langford 1 | 1 (0.03%) | 8E-39 | 5-272 | 2-266 | 167 | 24 | 273 | ref|YP_004193340.1| | choline kinase [Mycoplasma haemofelis str. Langford 1] ref|W... |
| 859194 | Mycoplasma haemofelis Ohio2 | 1 (0.03%) | 5E-38 | 5-272 | 2-266 | 164 | 24 | 273 | ref|YP_005906876.1| | choline kinase [Mycoplasma haemofelis Ohio2] ref|WP_01458425... |
| 171632 | Mycoplasma ovis | 1 (0.03%) | 4E-37 | 1-266 | 1-271 | 161 | 24 | 274 | ref|YP_008928377.1| | choline kinase [Mycoplasma ovis str. Michigan] ref|WP_024071... |
| 1197325 | Mycoplasma wenyonii str. Massachusetts | 1 (0.03%) | 4E-35 | 1-264 | 1-267 | 154 | 24 | 270 | ref|YP_006519213.1| | putative choline kinase [Mycoplasma wenyonii str. Massachuse... |
| 441768 | Acholeplasma laidlawii PG-8A | 1 (0.03%) | 8E-36 | 4-250 | 5-258 | 157 | 23 | 258 | ref|YP_001620856.1| | choline/ethanolamine kinase [Acholeplasma laidlawii PG-8A] r... |