old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 .
	MDLKKAVAFLCEKLQVVETDIFKIEQIHSGFTNFSFFCELKDHSKFQIRLSRKDVILDRRNEQIILQLVEPFFSNPFVYFDVTTGNAIKRWIEGTQPKRATDLFLCRLVESLKKVHSVDWKPFANELLIFDPLVYFEKTKLSAFYKRLYLNLTKKHIDIPKTLCHHDATFDNLVWTPKKQVILIDFEWSCVDNPYYEIANIIREELTIETANKLIDIYGGLKRKLVFETVIYVLLFAFQWTEIMPQTEAILNYRKWVEKRLEYFLKALFPSIWKQAQKNS
tmhmm (0)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (2%)	XX-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXX
psipred	--HHHHHHHHHHH----HHH-EEEEEE---EE--EEEEEE---EEEEEE---------HHHHHHHHHHHH------EEEEE-----EEEEE-----------HHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----EEEE--------EEEE----EEEE---------HHHHHHHHHHHH--HHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---

# SignalP-4.0 euk predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    20	    0.253
  max. Y    20	    0.177
  max. S     1	    0.174
  mean S     1-19   0.116
       D     1-19   0.144    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.144 D-cutoff=0.450 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-280	alignment	3c5iA_309	1-343	0.5893	TRANSFERASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	4E-67	1-280	1-280	261	100	280	ref|NP_073027.1|	choline/ethanolamine kinase, [Mycoplasma genitalium G37] ref...
1112856	Mycoplasma pneumoniae 309	1 (0.03%)	5E-61	1-277	1-277	240	75	277	ref|YP_005175774.1|	putative choline kinase [Mycoplasma pneumoniae 309] ref|YP_0...
272634	Mycoplasma pneumoniae M129	1 (0.03%)	1E-60	1-277	1-277	239	75	277	ref|NP_110221.1|	choline kinase [Mycoplasma pneumoniae M129] ref|WP_010874889...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	2E-60	1-277	1-277	238	75	277	ref|YP_007348105.1|	Thiamine kinase [Mycoplasma pneumoniae M129-B7] ref|WP_01534...
708616	Mycoplasma gallisepticum str. F	1 (0.03%)	5E-49	1-272	3-271	200	38	274	ref|YP_005880470.1|	putative choline kinase [Mycoplasma gallisepticum str. F] re...
710128	Mycoplasma gallisepticum str. R(high)	1 (0.03%)	3E-48	1-272	1-269	198	38	274	ref|NP_852960.2|	putative choline kinase [Mycoplasma gallisepticum str. R(low...
1159204	Mycoplasma gallisepticum NC08_2008.031-4-3P	1 (0.03%)	1E-47	1-272	1-269	196	38	274	ref|YP_006581074.1|	choline kinase [Mycoplasma gallisepticum VA94_7994-1-7P] ref...
1006581	Mycoplasma gallisepticum S6	1 (0.03%)	2E-47	1-272	1-269	195	38	274	ref|YP_008894115.1|	choline kinase [Mycoplasma gallisepticum S6] ref|WP_01188393...
1048830	Mycoplasma iowae 695	1 (0.03%)	2E-32	1-266	1-267	145	33	272	ref|WP_004024853.1|	choline kinase [Mycoplasma iowae] gb|EGZ31382.1| choline kin...
272633	Mycoplasma penetrans HF-2	2 (0.06%)	6E-37	4-269	13-278	160	27	272	ref|NP_757701.1|	choline kinase [Mycoplasma penetrans HF-2] ref|WP_011077141....
984991	Mycoplasma parvum	1 (0.03%)	1E-32	1-266	1-272	146	27	275	ref|YP_008679902.1|	choline kinase [Mycoplasma parvum str. Indiana] ref|WP_02276...
1212765	Candidatus Mycoplasma haemolamae str. Purdue	1 (0.03%)	7E-34	1-265	1-271	150	26	274	ref|YP_006530112.1|	putative choline kinase [Candidatus Mycoplasma haemolamae st...
768700	Mycoplasma suis str. Illinois	1 (0.03%)	1E-35	1-266	1-272	156	25	275	ref|YP_004250407.1|	choline kinase [Mycoplasma suis str. Illinois] ref|YP_004249...
1116213	Candidatus Mycoplasma haemominutum 'Birmingham 1'	1 (0.03%)	7E-34	1-264	1-269	150	25	272	ref|YP_007766432.1|	choline kinase [Candidatus Mycoplasma haemominutum 'Birmingh...
1111676	Mycoplasma haemocanis str. Illinois	1 (0.03%)	2E-39	5-272	2-266	169	24	273	ref|YP_005065212.1|	choline kinase [Mycoplasma haemocanis str. Illinois] ref|WP_...
941640	Mycoplasma haemofelis str. Langford 1	1 (0.03%)	8E-39	5-272	2-266	167	24	273	ref|YP_004193340.1|	choline kinase [Mycoplasma haemofelis str. Langford 1] ref|W...
859194	Mycoplasma haemofelis Ohio2	1 (0.03%)	5E-38	5-272	2-266	164	24	273	ref|YP_005906876.1|	choline kinase [Mycoplasma haemofelis Ohio2] ref|WP_01458425...
171632	Mycoplasma ovis	1 (0.03%)	4E-37	1-266	1-271	161	24	274	ref|YP_008928377.1|	choline kinase [Mycoplasma ovis str. Michigan] ref|WP_024071...
1197325	Mycoplasma wenyonii str. Massachusetts	1 (0.03%)	4E-35	1-264	1-267	154	24	270	ref|YP_006519213.1|	putative choline kinase [Mycoplasma wenyonii str. Massachuse...
441768	Acholeplasma laidlawii PG-8A	1 (0.03%)	8E-36	4-250	5-258	157	23	258	ref|YP_001620856.1|	choline/ethanolamine kinase [Acholeplasma laidlawii PG-8A] r...