old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380 . 390 . 400 . 410 . 420 . 430 . 440 . 450
	MTLYEFFLNQKLVYQSSPHFNGVFLTILEHYGFQFKTIDKLWKSKLLITSELTDKIKQQLKCYFIEKIPLPYLLGTIQLRKLTFKTKKGVFIPRIDSLALIASVNLKKIKTALDLCCGSGTLAIALKKKCDTLDVYGSDIDIQALKLAQQNALINNVSINWIEADWFDCFNKIKTPIDLIVTNPPYLKKTQLNKTLNYEPKHSLVFQNKNSYFAYKQLFNLLLTKRSIKQLIFECSLFQKERLLNLFSIFKSRPIFNFQKQFIGMKVDNQKLPVVDIKNTKTIKQLLKMGLAGIVNTDTQMGLISYSESTLDKIKQRALNKHYVSMFGLEELKKLPKKLQQIASYFWPGSYTFIKNNKSYRVPKNLGLLNLFNAIGRVFCTSANISNQKPYTKLSDYQNDSYWIKQPCFIIRSTSKVQSNNTPSLVYNLDTKQLVRTTAKQTKQFHKLITKHQLAI
tmhmm (0)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (2%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXX---------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (2%)	-----------XXXXXX------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X
psipred	--HHHHHHHHHHH--------HHHHHHHHHH-----HHHHHH-------HHHHHHHHHHHHHHHH----HHHEEEEEEE--EEEEE---EE-----HHHHH---------EEEEE----HHHHHHHHHH----EEEEEE--HHHHHHHHHHHHH---EEEEEE-------HHH----EEEEE-----------HHH---HHHHH------HHHHHHHHHHHHHHH----EEEEEE---HHHHHHHHHHH--------------------------------HHHHHH-----EEE-----------HHHHHHHH---------EEEE-HHHHHH--HHHHHHHHHH----EEEEE--EEEE----HHHHHHHHHH--EEE-------------HHHHHHHHH-----EEEE-------------EEEE----EEEE-----HHHHHHHHHH-----
sam	--HHHHHHHHHHHHHHH----HHHHHHHHHHHH---HHHHEE-------HHHHHHHHHHHHHHHHH---HEHHH--EEE--EEEEE----------HHHHHHHHH-----EEEE---HHHHHHHHHHHH----EEEEE---HHHHHHHHHHHHHH---EEEEE------------EEEEEEE--------------E---HEEEE-----HHHHHHHHHHHHHH-----EEEEEE---HHHHHHHHHHHH-----EEEEE------EEEEEEEE--HH-HHHHHH------EEEEE-----------HHHHHHHHHH---HHHHHHH-HHHHHH--HHHHHHHHH-----EEEEE----------HHHHHHHHHH-EEEE-------------HHHHHHHHHH-----EEEEE----------EEEEE----HHHHHHHHHHHHHHHHHHHHH---
jufo	--HHHHHHHHHH------HHHHHHHHHHHHHH-----HHHHH-------HHHHHHHHHHHHHHHH----------HH-----EEEEE--EEE-----HHHHH--------EEEEEE---HHHHHHHHHH---EEEEHHHHHHHHHHHHHHHHHHH---HH------------------EEEEE---------------------------HHHHHHHHHHHHHH-----EEEEEEEHHHHHHHHHHHHHH---------------------------------HHHHHH--------------HHHHHHHHHHHHH------EEEEEEHHHHHHHHHHHHHHHHH----EEEEEEE--------HHHHHHHHHH--EEEEE------------HHHHHHHHHH---EEEEEEE----------EEEEEE--EEEEE-----HHHHHHHHHH-----

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    22	    0.110
  max. Y    16	    0.124
  max. S    13	    0.213
  mean S     1-15   0.148
       D     1-15   0.136    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.136 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-289	alignment	5u0nA_310	1-308	0.721200	--
	290-456	alignment	6f87A_101	1-341	0.825300	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	1E-109	1-456	1-456	403	100	456	ref|NP_072925.1|	HemK family modification methylase [Mycoplasma genitalium G3...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	4E-99	1-454	1-451	368	54	454	ref|NP_110050.1|	HemK family methylase [Mycoplasma pneumoniae M129] ref|YP_00...
861	Fusobacterium ulcerans	1 (0.03%)	9E-62	16-267	108-362	244	28	261	ref|WP_008696524.1|	N5-glutamine S-adenosyl-L-methionine-dependent methyltransfe...
997347	Fusobacterium nucleatum subsp. animalis ATCC 51191	1 (0.03%)	3E-57	46-267	3-231	229	28	231	gb|EGQ80257.1|	protein-(glutamine-N5) methyltransferase [Fusobacterium nucl...
347257	Mycoplasma agalactiae PG2	2 (0.05%)	9E-41	61-254	25-224	174	28	203	ref|YP_001256872.1|	protoporphirogen oxidase HEMK [Mycoplasma agalactiae PG2] re...
469617	Fusobacterium ulcerans ATCC 49185	1 (0.03%)	4E-61	17-267	109-362	242	27	260	ref|WP_005980799.1|	N5-glutamine S-adenosyl-L-methionine-dependent methyltransfe...
525919	Anaerococcus prevotii DSM 20548	1 (0.03%)	1E-58	26-255	13-244	233	27	236	ref|YP_003152501.1|	HemK family modification methylase [Anaerococcus prevotii DS...
478547	Campylobacter jejuni subsp. jejuni CG8421	1 (0.03%)	5E-40	20-267	10-250	172	27	255	ref|WP_002860037.1|	N5-glutamine S-adenosyl-L-methionine-dependent methyltransfe...
1614	Lactobacillus fructivorans	1 (0.03%)	2E-67	2-271	10-282	263	26	277	ref|WP_010021940.1|	N5-glutamine S-adenosyl-L-methionine-dependent methyltransfe...
245018	butyrate-producing bacterium SSC/2	1 (0.03%)	3E-67	1-267	1-273	262	26	277	ref|YP_007790522.1|	protein-(glutamine-N5) methyltransferase, release factor-spe...
658089	Lachnospiraceae bacterium 5_1_63FAA	2 (0.05%)	3E-66	1-267	1-273	259	26	277	ref|WP_009265462.1|	(glutamine-N5) methyltransferase [Lachnospiraceae bacterium ...
411484	Clostridium sp. SS2/1	1 (0.03%)	2E-66	1-267	1-273	259	26	277	ref|WP_008390548.1|	hypothetical protein [Clostridium sp. SS2/1] gb|EDS22074.1| ...
525310	Lactobacillus brevis subsp. gravesensis ATCC 27305	1 (0.03%)	6E-64	2-270	8-282	251	26	280	ref|WP_003553562.1|	N5-glutamine S-adenosyl-L-methionine-dependent methyltransfe...
525327	Lactobacillus hilgardii ATCC 8290	1 (0.03%)	7E-63	2-270	8-282	248	26	280	ref|WP_003559903.1|	N5-glutamine S-adenosyl-L-methionine-dependent methyltransfe...
1032505	Fusobacterium sp. OBRC1	1 (0.03%)	1E-59	20-267	106-357	237	26	257	gb|EUB34981.1|	protein-(glutamine-N5) methyltransferase, release factor-spe...
546275	Fusobacterium periodonticum ATCC 33693	1 (0.03%)	1E-59	32-267	115-357	237	26	245	ref|WP_005975817.1|	N5-glutamine S-adenosyl-L-methionine-dependent methyltransfe...
393480	Fusobacterium nucleatum subsp. polymorphum ATCC 10953	2 (0.05%)	2E-59	20-267	106-357	236	26	257	ref|WP_005896111.1|	N5-glutamine S-adenosyl-L-methionine-dependent methyltransfe...
999414	Fusobacterium nucleatum subsp. animalis F0419	1 (0.03%)	6E-59	17-267	103-357	235	26	260	ref|WP_005909557.1|	N5-glutamine S-adenosyl-L-methionine-dependent methyltransfe...
851	Fusobacterium nucleatum	5 (0.12%)	4E-59	17-267	103-357	235	26	260	ref|WP_008795847.1|	N5-glutamine S-adenosyl-L-methionine-dependent methyltransfe...
416591	Thermotoga lettingae TMO	3 (0.07%)	3E-57	1-267	1-265	229	26	272	ref|YP_001470611.1|	HemK family modification methylase [Thermotoga lettingae TMO...