old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380 . 390 . 400 . 410 . 420 . 430 . 440 . 450 . 460 . 470 . 480 . 490 . 500 . 510 . 520 . 530 . 540 . 550 . 560
	MLVFLILLPFLLLVIFGAYLLVCLFVRQNNLLLKKTKQLYNNLKLSNFNCVISPFQLLRNEKQALEQSIKVLKQFQIKFDNEINSAFEQLTVYSKPNNIYRFIWFNRNIKLLNKNLQHLYTKQQEYINLTKNAIVYFNNSYDCLVFYRQAFCFLNQFINNFLIEKYDSLFYLNVLNRISLLFKEIENCIQAKDVEKQIAFLNKLHNILSQTIITANRQYMFDIKLSYLTHHFKVLIQKVKQMELMKNKVINSQDLLKLHELINNITIKLKDCTNFLNNLNLMLCERNMDEVQEAISWLFQAVSSKEKSINLVVENIDDFRNQIQQYEKKNELLKTTIKAIELVFQNETDVHDLIIELNENCDLITKNINNLNHQSLAQNQINYEKLFYLMSQTNQALEKLKNSLTDLLNLAVNKFDDYRFFVYTLDDFRFKFFQIENLISDQDLKVPAKTLQVINKSKLELDNIFTEANNNYLGTFNLFSEKIDLLQIQLTEVICDVVSLVNLRLMCKQAFLFANKYRQKSSHIDRSLEQLTKLYNRQNYPDTLEGLINLLTKIKTNTKQDYLELN
tmhmm (1)	-XXXXXXXXXXXXXXXXXXXXXX---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (6%)	-XXXXXXXXXXXXXXX------------XXXXXXXXXXXXXXXXX-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (14%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----------XXXXXXXXXXXXXXXXXXXXX---------------XXXXXXXXXXXXXXXXXXXXX------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (2%)	-------------------------------------------------------------X---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXX-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXX-X
psipred	--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HH---HHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHH-HH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-EEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHH------

# SignalP-4.0 euk predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    18	    0.342
  max. Y    18	    0.243
  max. S     1	    0.456
  mean S     1-17   0.219
       D     1-17   0.233    0.500  NO
Name=tmp_signalp_seq	SP='NO' D=0.233 D-cutoff=0.500 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-566	alignment	4uxvA_201	1-522	0.6505	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
488339	synthetic Mycoplasma genitalium JCVI-1.0	1 (0.09%)	1E-101	1-566	1-566	376	100	566	ref|NP_073070.1|	hypothetical protein MG_397 [Mycoplasma genitalium G37] ref|...
662947	Mycoplasma genitalium M2288	1 (0.09%)	1E-101	1-566	1-566	374	100	566	ref|YP_006601445.1|	hypothetical protein CM5_02345 [Mycoplasma genitalium M2288]...
662946	Mycoplasma genitalium M6282	1 (0.09%)	1E-101	1-566	1-566	376	99	566	ref|YP_006600432.1|	hypothetical protein CM3_02500 [Mycoplasma genitalium M6282]...
662945	Mycoplasma genitalium M6320	1 (0.09%)	1E-100	1-566	1-566	374	99	566	ref|YP_006600941.1|	hypothetical protein CM1_02415 [Mycoplasma genitalium M6320]...
663918	Mycoplasma genitalium M2321	1 (0.09%)	1E-101	1-566	1-566	374	99	566	ref|YP_006599949.1|	hypothetical protein CM9_02385 [Mycoplasma genitalium M2321]...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.09%)	1E-101	4-566	7-569	376	56	563	ref|NP_110285.1|	hypothetical protein MPN596 [Mycoplasma pneumoniae M129] ref...
1112856	Mycoplasma pneumoniae 309	1 (0.09%)	1E-101	4-566	7-569	376	56	563	ref|YP_005175844.1|	hypothetical protein MPNA5960 [Mycoplasma pneumoniae 309] re...
1006581	Mycoplasma gallisepticum S6	1 (0.09%)	2E-73	1-566	15-576	283	20	574	ref|YP_008894528.1|	hypothetical protein GCW_03415 [Mycoplasma gallisepticum S6]...
710128	Mycoplasma gallisepticum str. R(high)	1 (0.09%)	4E-73	1-566	21-582	282	20	574	ref|NP_853387.1|	hypothetical protein MGA_0409 [Mycoplasma gallisepticum str....
708616	Mycoplasma gallisepticum str. F	1 (0.09%)	6E-73	1-566	21-582	282	20	574	ref|YP_005880920.1|	hypothetical protein MGF_4810 [Mycoplasma gallisepticum str....
1159204	Mycoplasma gallisepticum NC08_2008.031-4-3P	1 (0.09%)	2E-72	1-566	21-582	280	20	574	ref|YP_006581502.1|	hypothetical protein HFMG94VAA_4782 [Mycoplasma gallisepticu...
272633	Mycoplasma penetrans HF-2	1 (0.09%)	2E-63	1-553	5-554	250	18	559	ref|NP_757733.1|	integral membrane protein [Mycoplasma penetrans HF-2] ref|WP...
999413	Clostridium innocuum 2959	1 (0.09%)	3E-88	5-564	11-573	332	17	572	ref|WP_002608901.1|	hypothetical protein [unclassified Erysipelotrichaceae] gb|E...
1151410	Clostridium difficile P28	1 (0.09%)	2E-87	5-564	11-573	330	17	572	ref|WP_021420813.1|	septation ring formation regulator, EzrA family protein [[Cl...
658657	Erysipelotrichaceae bacterium 21_3	1 (0.09%)	2E-87	5-564	11-573	330	17	572	ref|WP_008817344.1|	hypothetical protein [Firmicutes] gb|EFR35729.1| septation r...
658659	Erysipelotrichaceae bacterium 3_1_53	1 (0.09%)	2E-85	5-564	11-573	323	16	572	ref|WP_009272154.1|	septation ring formation regulator EzrA [Erysipelotrichaceae...
1074451	Lactobacillus curvatus CRL 705	1 (0.09%)	2E-45	7-559	4-554	190	16	559	ref|WP_004270693.1|	selenide, water dikinase [Lactobacillus curvatus] gb|EHE8565...
1185325	Lactobacillus coryniformis subsp. coryniformis CECT 5711	1 (0.09%)	6E-73	18-561	2-543	282	15	557	ref|WP_003680758.1|	selenide, water dikinase [Lactobacillus coryniformis] gb|EJN...
1610	Lactobacillus coryniformis	1 (0.09%)	1E-72	19-561	16-556	281	15	556	ref|WP_010009745.1|	selenide, water dikinase [Lactobacillus coryniformis]
457402	Eubacterium sp. 3_1_31	1 (0.09%)	6E-63	32-563	38-572	248	15	544	ref|WP_008688277.1|	hypothetical protein [Eubacterium sp. 3_1_31] gb|EHO84835.1|...