old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280
	MKKINVVYNPAFNPISSKLNQTQLLKNASEELDIELKFFTSFDINTTKAKANLPFISNKILFMDKNIALARWLESNGFEVINSSIGINNADNKGLSHAIIAQYPFIKQIKTLLGPQNFDREWNPVMLDVFINQIKQSMEFPVIVKSVFGSFGDYVFLCLDEQKLRKTLMSFNQQAIVQKYITCSKGESVRVIVVNNKVIGALHTTNNSDFRSNLNKGAKAERFFLNKEQENLAVKISKVMQLFYCGIDFLFDQDRSLIFCEVNPNVQLTRSSMYLNTNLAIELLKAI
tmhmm (0)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (0%)	X----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	-EEEEEEE-----------HHHHHHHHHHHH---EEEE--HHHHHH--------EEE---------HHHHHHHHH---EEE--HHHHHHHHHHHHHHHHHHH----------------HHH------HHHHHHHHHH----EEEEE---------EEE--HHHHHHHHHH----EEEEEEE-----EEEEEEEE--EEEEEEEE------HH-EE---EEE-----HHHHHHHHHHHHHH---EEEEEEEEE----EEEEEEE--HHHHHHHHHH---HHHHHHHH-

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    29	    0.149
  max. Y    29	    0.186
  max. S    13	    0.416
  mean S     1-28   0.272
       D     1-28   0.220    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.220 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-287	alignment	4iwxA_201	1-295	0.7869	LIGASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	2E-70	1-287	1-287	272	100	287	ref|YP_006600027.1|	alpha-L-glutamate ligase [Mycoplasma genitalium M6282] ref|Y...
2097	Mycoplasma genitalium	1 (0.03%)	1E-51	63-287	1-225	209	100	225	pir||C64201	ribosomal protein S6 modification protein rimK homolog - Myc...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	1E-65	1-287	1-287	256	69	287	ref|NP_109704.1|	ribosomal S6 modification protein [Mycoplasma pneumoniae M12...
1202534	Clostridium sartagoforme AAU1	1 (0.03%)	6E-52	3-287	2-292	210	33	296	ref|WP_016206742.1|	RimK family alpha-L-glutamate ligase [Clostridium sartagofor...
457396	Clostridium sp. 7_2_43FAA	2 (0.05%)	2E-53	3-287	2-292	215	31	296	ref|WP_008679322.1|	RimK family alpha-L-glutamate ligase [Clostridium sp. 7_2_43...
9258	Ornithorhynchus anatinus	1 (0.03%)	6E-25	153-286	1-137	121	29	137	ref|XP_001511443.1|	PREDICTED: beta-citryl-glutamate synthase B-like, partial [O...
411463	Eubacterium ventriosum ATCC 27560	3 (0.07%)	5E-64	1-287	1-287	250	28	293	ref|WP_005361430.1|	hypothetical protein [Eubacterium ventriosum] gb|EDM51245.1|...
702978	Salmonella enterica subsp. enterica serovar Enteritidis str. SE30663	1 (0.03%)	3E-41	136-287	1-155	175	28	156	ref|WP_001699719.1|	ribosomal protein S6 modification protein [Salmonella enteri...
1208662	Cronobacter malonaticus 507	1 (0.03%)	2E-39	143-287	1-148	169	28	149	ref|WP_007782408.1|	Ribosomal protein S6 glutaminyl transferase [Cronobacter mal...
1208590	Cronobacter turicensis 564	1 (0.03%)	2E-39	143-287	1-148	169	28	149	ref|WP_007768668.1|	Ribosomal protein S6 glutaminyl transferase [Cronobacter tur...
1074000	Cronobacter universalis NCTC 9529	1 (0.03%)	2E-39	143-287	1-148	169	28	149	ref|WP_007707286.1|	Ribosomal protein S6 glutaminyl transferase [Cronobacter] em...
1208661	Cronobacter dublinensis 582	1 (0.03%)	3E-39	143-287	1-148	168	28	149	ref|WP_007747024.1|	Ribosomal protein S6 glutaminyl transferase [Cronobacter dub...
357809	Clostridium phytofermentans ISDg	5 (0.12%)	6E-62	3-287	2-290	244	27	298	ref|YP_001559853.1|	alpha-L-glutamate ligase [Clostridium phytofermentans ISDg] ...
393087	Gracilibacillus lacisalsi	1 (0.03%)	4E-62	2-287	3-288	244	27	293	ref|WP_018932495.1|	hypothetical protein [Gracilibacillus lacisalsi]
1235802	Eubacterium plexicaudatum ASF492	1 (0.03%)	2E-57	1-286	3-290	229	27	292	ref|WP_004065543.1|	RimK family alpha-L-glutamate ligase [Eubacterium plexicauda...
1216008	Amphibacillus jilinensis	1 (0.03%)	4E-54	3-287	4-290	218	27	291	ref|WP_017470841.1|	hypothetical protein [Amphibacillus jilinensis]
406124	Bacillus sp. m3-13	1 (0.03%)	3E-43	1-232	1-237	182	27	243	ref|WP_010195850.1|	alpha-L-glutamate ligase [Bacillus sp. m3-13]
656374	Escherichia coli E1520	1 (0.03%)	7E-37	155-287	18-153	161	27	137	ref|WP_001351687.1|	alpha-L-glutamate ligase [Escherichia coli] gb|EGB34221.1| R...
419109	Vibrio parahaemolyticus AQ3810	2 (0.05%)	5E-71	45-287	8-240	274	26	247	gb|EXF72860.1|	ribosomal protein S6 modification protein [Vibrio parahaemol...
1147159	Ornithinibacillus scapharcae	1 (0.03%)	6E-62	1-287	1-290	243	26	294	ref|WP_010099010.1|	hypothetical protein [Ornithinibacillus scapharcae]