| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 |
| | MKKINVVYNPAFNPISSKLNQTQLLKNASEELDIELKFFTSFDINTTKAKANLPFISNKILFMDKNIALARWLESNGFEVINSSIGINNADNKGLSHAIIAQYPFIKQIKTLLGPQNFDREWNPVMLDVFINQIKQSMEFPVIVKSVFGSFGDYVFLCLDEQKLRKTLMSFNQQAIVQKYITCSKGESVRVIVVNNKVIGALHTTNNSDFRSNLNKGAKAERFFLNKEQENLAVKISKVMQLFYCGIDFLFDQDRSLIFCEVNPNVQLTRSSMYLNTNLAIELLKAI |
| tmhmm (0) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (0%) | X---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| psipred | -EEEEEEE-----------HHHHHHHHHHHH---EEEE--HHHHHH--------EEE---------HHHHHHHHH---EEE--HHHHHHHHHHHHHHHHHHH----------------HHH------HHHHHHHHHH----EEEEE---------EEE--HHHHHHHHHH----EEEEEEE-----EEEEEEEE--EEEEEEEE------HH-EE---EEE-----HHHHHHHHHHHHHH---EEEEEEEEE----EEEEEEE--HHHHHHHHHH---HHHHHHHH- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.03%) | 2E-70 | 1-287 | 1-287 | 272 | 100 | 287 | ref|YP_006600027.1| | alpha-L-glutamate ligase [Mycoplasma genitalium M6282] ref|Y... |
| 2097 | Mycoplasma genitalium | 1 (0.03%) | 1E-51 | 63-287 | 1-225 | 209 | 100 | 225 | pir||C64201 | ribosomal protein S6 modification protein rimK homolog - Myc... |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.03%) | 1E-65 | 1-287 | 1-287 | 256 | 69 | 287 | ref|NP_109704.1| | ribosomal S6 modification protein [Mycoplasma pneumoniae M12... |
| 1202534 | Clostridium sartagoforme AAU1 | 1 (0.03%) | 6E-52 | 3-287 | 2-292 | 210 | 33 | 296 | ref|WP_016206742.1| | RimK family alpha-L-glutamate ligase [Clostridium sartagofor... |
| 457396 | Clostridium sp. 7_2_43FAA | 2 (0.05%) | 2E-53 | 3-287 | 2-292 | 215 | 31 | 296 | ref|WP_008679322.1| | RimK family alpha-L-glutamate ligase [Clostridium sp. 7_2_43... |
| 9258 | Ornithorhynchus anatinus | 1 (0.03%) | 6E-25 | 153-286 | 1-137 | 121 | 29 | 137 | ref|XP_001511443.1| | PREDICTED: beta-citryl-glutamate synthase B-like, partial [O... |
| 411463 | Eubacterium ventriosum ATCC 27560 | 3 (0.07%) | 5E-64 | 1-287 | 1-287 | 250 | 28 | 293 | ref|WP_005361430.1| | hypothetical protein [Eubacterium ventriosum] gb|EDM51245.1|... |
| 702978 | Salmonella enterica subsp. enterica serovar Enteritidis str. SE30663 | 1 (0.03%) | 3E-41 | 136-287 | 1-155 | 175 | 28 | 156 | ref|WP_001699719.1| | ribosomal protein S6 modification protein [Salmonella enteri... |
| 1208662 | Cronobacter malonaticus 507 | 1 (0.03%) | 2E-39 | 143-287 | 1-148 | 169 | 28 | 149 | ref|WP_007782408.1| | Ribosomal protein S6 glutaminyl transferase [Cronobacter mal... |
| 1208590 | Cronobacter turicensis 564 | 1 (0.03%) | 2E-39 | 143-287 | 1-148 | 169 | 28 | 149 | ref|WP_007768668.1| | Ribosomal protein S6 glutaminyl transferase [Cronobacter tur... |
| 1074000 | Cronobacter universalis NCTC 9529 | 1 (0.03%) | 2E-39 | 143-287 | 1-148 | 169 | 28 | 149 | ref|WP_007707286.1| | Ribosomal protein S6 glutaminyl transferase [Cronobacter] em... |
| 1208661 | Cronobacter dublinensis 582 | 1 (0.03%) | 3E-39 | 143-287 | 1-148 | 168 | 28 | 149 | ref|WP_007747024.1| | Ribosomal protein S6 glutaminyl transferase [Cronobacter dub... |
| 357809 | Clostridium phytofermentans ISDg | 5 (0.12%) | 6E-62 | 3-287 | 2-290 | 244 | 27 | 298 | ref|YP_001559853.1| | alpha-L-glutamate ligase [Clostridium phytofermentans ISDg] ... |
| 393087 | Gracilibacillus lacisalsi | 1 (0.03%) | 4E-62 | 2-287 | 3-288 | 244 | 27 | 293 | ref|WP_018932495.1| | hypothetical protein [Gracilibacillus lacisalsi] |
| 1235802 | Eubacterium plexicaudatum ASF492 | 1 (0.03%) | 2E-57 | 1-286 | 3-290 | 229 | 27 | 292 | ref|WP_004065543.1| | RimK family alpha-L-glutamate ligase [Eubacterium plexicauda... |
| 1216008 | Amphibacillus jilinensis | 1 (0.03%) | 4E-54 | 3-287 | 4-290 | 218 | 27 | 291 | ref|WP_017470841.1| | hypothetical protein [Amphibacillus jilinensis] |
| 406124 | Bacillus sp. m3-13 | 1 (0.03%) | 3E-43 | 1-232 | 1-237 | 182 | 27 | 243 | ref|WP_010195850.1| | alpha-L-glutamate ligase [Bacillus sp. m3-13] |
| 656374 | Escherichia coli E1520 | 1 (0.03%) | 7E-37 | 155-287 | 18-153 | 161 | 27 | 137 | ref|WP_001351687.1| | alpha-L-glutamate ligase [Escherichia coli] gb|EGB34221.1| R... |
| 419109 | Vibrio parahaemolyticus AQ3810 | 2 (0.05%) | 5E-71 | 45-287 | 8-240 | 274 | 26 | 247 | gb|EXF72860.1| | ribosomal protein S6 modification protein [Vibrio parahaemol... |
| 1147159 | Ornithinibacillus scapharcae | 1 (0.03%) | 6E-62 | 1-287 | 1-290 | 243 | 26 | 294 | ref|WP_010099010.1| | hypothetical protein [Ornithinibacillus scapharcae] |