old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 88367 [SSGCID - MygeA.20140.a] [2019-01-18] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] Endoribonuclease YbeY (MG_388) - BATCH:88256

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150 
 
MKSSFSINSSRLFKRFFGKNYQAGVELCFQIIKSSLNLSFDPEFALLIVSCSKMKKLNKQFLKRRGCTDVISLCYNETETGFSLAIGEIFLCPKYIFKKAKEIGCNNWFLLTRCLIHGILHLFEFNHEESEAFESVTMFFQDAIHEEILSVWKF
tmhmm (0)
----------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)
----------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
----------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)
X---------------------------------------------------------------------------------------------------------------------------------------------------------
psipred
---EEEEEE----HHHHHHHHHHHHHHHHHHHHHH------EEEEEEEE-HHHHHHHHHHH---------EEE---------------EEE-HHHHHHHHHH----HHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHH---

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    46	    0.118
  max. Y     3	    0.231
  max. S     1	    0.539
  mean S     1-2    0.538
       D     1-2    0.350    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.350 D-cutoff=0.450 Networks=SignalP-TM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-154     alignment     1xm5A_201     1-152   0.7246   STRUCTURAL GENOMICS, UNKNOWN FUNCTION


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
1238993Mycoplasma pneumoniae M129-B71 (0.04%)1E-391-1531-15316875153ref|NP_110258.2|metalloprotein [Mycoplasma pneumoniae M129] ref|YP_007348141...
722438Mycoplasma pneumoniae FH1 (0.04%)6E-3413-1532-14214974141ref|YP_005881567.1|translation metalloprotein YbeY [Mycoplasma pneumoniae FH] r...
243272Mycoplasma arthritidis 158L3-11 (0.04%)7E-2153-1484-1011053099ref|YP_002000121.1|hypothetical protein MARTH_orf636 [Mycoplasma arthritidis 15...
4558Sorghum bicolor2 (0.07%)3E-2943-131154-2431332990ref|XP_002451811.1|hypothetical protein SORBIDRAFT_04g008060 [Sorghum bicolor] ...
443143Geobacter sp. M181 (0.04%)3E-2840-1504-11313029113ref|YP_004200207.1|hypothetical protein GM18_3497 [Geobacter sp. M18] ref|WP_01...
582899Hyphomicrobium denitrificans ATCC 518881 (0.04%)4E-2744-15354-15612629110ref|YP_003757599.1|hypothetical protein Hden_3487 [Hyphomicrobium denitrificans...
637389Acidithiobacillus caldus ATCC 517561 (0.04%)9E-2344-12753-1371122985ref|WP_004870685.1|metalloprotease [Acidithiobacillus caldus] gb|EET27341.1| hy...
42817Corynebacterium argentoratense1 (0.04%)1E-3918-15232-16816728143ref|YP_008479185.1|hypothetical protein CARG_07165 [Corynebacterium argentorate...
1087454Corynebacterium pseudotuberculosis 1/06-A1 (0.04%)1E-3636-1521-12115828126ref|YP_005695086.1|Metalloprotease [Corynebacterium pseudotuberculosis CIP 52.9...
1087453Corynebacterium pseudotuberculosis 42/02-A1 (0.04%)1E-3636-1521-12115828126ref|YP_005693023.1|metalloprotease [Corynebacterium pseudotuberculosis 42/02-A]...
428126Clostridium spiroforme DSM 15521 (0.04%)6E-361-1531-14915528158ref|WP_004610339.1|rRNA maturation factor [[Clostridium] spiroforme] gb|EDS7427...
1045004Oenococcus kitaharae DSM 173301 (0.04%)1E-356-1471-14815528148ref|WP_007746517.1|rRNA maturation factor [Oenococcus kitaharae] gb|EHN59544.1|...
330214Candidatus Nitrospira defluvii1 (0.04%)6E-3330-14621-13914528119ref|YP_003799682.1|hypothetical protein NIDE4088 [Candidatus Nitrospira defluvi...
29760Vitis vinifera3 (0.11%)8E-3236-1311073-11691422897ref|XP_002278343.1|PREDICTED: receptor-like protein kinase HSL1-like [Vitis vin...
1303729Leptospira borgpetersenii serovar Hardjo-bovis str. Sponselee1 (0.04%)1E-2731-1527-14312828138ref|YP_797684.1|metal-dependent hydrolase [Leptospira borgpetersenii serovar...
590168Thermotoga naphthophila RKU-101 (0.04%)7E-2722-15315-13812528132ref|YP_001244873.1|hypothetical protein Tpet_1283 [Thermotoga petrophila RKU-1]...
379066Gemmatimonas aurantiaca T-271 (0.04%)5E-2644-14956-16012228107ref|YP_002761225.1|hypothetical protein GAU_1713 [Gemmatimonas aurantiaca T-27]...
123214Persephonella marina EX-H11 (0.04%)2E-243-1522-14711728151ref|YP_002731717.1|hypothetical protein PERMA_1963 [Persephonella marina EX-H1]...
416591Thermotoga lettingae TMO1 (0.04%)1E-2337-1485-11011528112ref|YP_001471588.1|hypothetical protein Tlet_1970 [Thermotoga lettingae TMO] re...
997886Bacteroides ovatus CL03T12C181 (0.04%)2E-2243-14437-13411128102ref|WP_004298035.1|rRNA maturation factor [Bacteroides] gb|EDO13359.1| translat...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington