| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 |
| | MKSSFSINSSRLFKRFFGKNYQAGVELCFQIIKSSLNLSFDPEFALLIVSCSKMKKLNKQFLKRRGCTDVISLCYNETETGFSLAIGEIFLCPKYIFKKAKEIGCNNWFLLTRCLIHGILHLFEFNHEESEAFESVTMFFQDAIHEEILSVWKF |
| tmhmm (0) | ---------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (1%) | X--------------------------------------------------------------------------------------------------------------------------------------------------------- |
| psipred | ---EEEEEE----HHHHHHHHHHHHHHHHHHHHHH------EEEEEEEE-HHHHHHHHHHH---------EEE---------------EEE-HHHHHHHHHH----HHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHH--- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.04%) | 1E-39 | 1-153 | 1-153 | 168 | 75 | 153 | ref|NP_110258.2| | metalloprotein [Mycoplasma pneumoniae M129] ref|YP_007348141... |
| 722438 | Mycoplasma pneumoniae FH | 1 (0.04%) | 6E-34 | 13-153 | 2-142 | 149 | 74 | 141 | ref|YP_005881567.1| | translation metalloprotein YbeY [Mycoplasma pneumoniae FH] r... |
| 243272 | Mycoplasma arthritidis 158L3-1 | 1 (0.04%) | 7E-21 | 53-148 | 4-101 | 105 | 30 | 99 | ref|YP_002000121.1| | hypothetical protein MARTH_orf636 [Mycoplasma arthritidis 15... |
| 4558 | Sorghum bicolor | 2 (0.07%) | 3E-29 | 43-131 | 154-243 | 133 | 29 | 90 | ref|XP_002451811.1| | hypothetical protein SORBIDRAFT_04g008060 [Sorghum bicolor] ... |
| 443143 | Geobacter sp. M18 | 1 (0.04%) | 3E-28 | 40-150 | 4-113 | 130 | 29 | 113 | ref|YP_004200207.1| | hypothetical protein GM18_3497 [Geobacter sp. M18] ref|WP_01... |
| 582899 | Hyphomicrobium denitrificans ATCC 51888 | 1 (0.04%) | 4E-27 | 44-153 | 54-156 | 126 | 29 | 110 | ref|YP_003757599.1| | hypothetical protein Hden_3487 [Hyphomicrobium denitrificans... |
| 637389 | Acidithiobacillus caldus ATCC 51756 | 1 (0.04%) | 9E-23 | 44-127 | 53-137 | 112 | 29 | 85 | ref|WP_004870685.1| | metalloprotease [Acidithiobacillus caldus] gb|EET27341.1| hy... |
| 42817 | Corynebacterium argentoratense | 1 (0.04%) | 1E-39 | 18-152 | 32-168 | 167 | 28 | 143 | ref|YP_008479185.1| | hypothetical protein CARG_07165 [Corynebacterium argentorate... |
| 1087454 | Corynebacterium pseudotuberculosis 1/06-A | 1 (0.04%) | 1E-36 | 36-152 | 1-121 | 158 | 28 | 126 | ref|YP_005695086.1| | Metalloprotease [Corynebacterium pseudotuberculosis CIP 52.9... |
| 1087453 | Corynebacterium pseudotuberculosis 42/02-A | 1 (0.04%) | 1E-36 | 36-152 | 1-121 | 158 | 28 | 126 | ref|YP_005693023.1| | metalloprotease [Corynebacterium pseudotuberculosis 42/02-A]... |
| 428126 | Clostridium spiroforme DSM 1552 | 1 (0.04%) | 6E-36 | 1-153 | 1-149 | 155 | 28 | 158 | ref|WP_004610339.1| | rRNA maturation factor [[Clostridium] spiroforme] gb|EDS7427... |
| 1045004 | Oenococcus kitaharae DSM 17330 | 1 (0.04%) | 1E-35 | 6-147 | 1-148 | 155 | 28 | 148 | ref|WP_007746517.1| | rRNA maturation factor [Oenococcus kitaharae] gb|EHN59544.1|... |
| 330214 | Candidatus Nitrospira defluvii | 1 (0.04%) | 6E-33 | 30-146 | 21-139 | 145 | 28 | 119 | ref|YP_003799682.1| | hypothetical protein NIDE4088 [Candidatus Nitrospira defluvi... |
| 29760 | Vitis vinifera | 3 (0.11%) | 8E-32 | 36-131 | 1073-1169 | 142 | 28 | 97 | ref|XP_002278343.1| | PREDICTED: receptor-like protein kinase HSL1-like [Vitis vin... |
| 1303729 | Leptospira borgpetersenii serovar Hardjo-bovis str. Sponselee | 1 (0.04%) | 1E-27 | 31-152 | 7-143 | 128 | 28 | 138 | ref|YP_797684.1| | metal-dependent hydrolase [Leptospira borgpetersenii serovar... |
| 590168 | Thermotoga naphthophila RKU-10 | 1 (0.04%) | 7E-27 | 22-153 | 15-138 | 125 | 28 | 132 | ref|YP_001244873.1| | hypothetical protein Tpet_1283 [Thermotoga petrophila RKU-1]... |
| 379066 | Gemmatimonas aurantiaca T-27 | 1 (0.04%) | 5E-26 | 44-149 | 56-160 | 122 | 28 | 107 | ref|YP_002761225.1| | hypothetical protein GAU_1713 [Gemmatimonas aurantiaca T-27]... |
| 123214 | Persephonella marina EX-H1 | 1 (0.04%) | 2E-24 | 3-152 | 2-147 | 117 | 28 | 151 | ref|YP_002731717.1| | hypothetical protein PERMA_1963 [Persephonella marina EX-H1]... |
| 416591 | Thermotoga lettingae TMO | 1 (0.04%) | 1E-23 | 37-148 | 5-110 | 115 | 28 | 112 | ref|YP_001471588.1| | hypothetical protein Tlet_1970 [Thermotoga lettingae TMO] re... |
| 997886 | Bacteroides ovatus CL03T12C18 | 1 (0.04%) | 2E-22 | 43-144 | 37-134 | 111 | 28 | 102 | ref|WP_004298035.1| | rRNA maturation factor [Bacteroides] gb|EDO13359.1| translat... |