old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150
	MKSSFSINSSRLFKRFFGKNYQAGVELCFQIIKSSLNLSFDPEFALLIVSCSKMKKLNKQFLKRRGCTDVISLCYNETETGFSLAIGEIFLCPKYIFKKAKEIGCNNWFLLTRCLIHGILHLFEFNHEESEAFESVTMFFQDAIHEEILSVWKF
tmhmm (0)	----------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)	X---------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	---EEEEEE----HHHHHHHHHHHHHHHHHHHHHH------EEEEEEEE-HHHHHHHHHHH---------EEE---------------EEE-HHHHHHHHHH----HHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHH---

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    46	    0.118
  max. Y     3	    0.231
  max. S     1	    0.539
  mean S     1-2    0.538
       D     1-2    0.350    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.350 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-154	alignment	1xm5A_201	1-152	0.7246	STRUCTURAL GENOMICS, UNKNOWN FUNCTION

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
1238993	Mycoplasma pneumoniae M129-B7	1 (0.04%)	1E-39	1-153	1-153	168	75	153	ref|NP_110258.2|	metalloprotein [Mycoplasma pneumoniae M129] ref|YP_007348141...
722438	Mycoplasma pneumoniae FH	1 (0.04%)	6E-34	13-153	2-142	149	74	141	ref|YP_005881567.1|	translation metalloprotein YbeY [Mycoplasma pneumoniae FH] r...
243272	Mycoplasma arthritidis 158L3-1	1 (0.04%)	7E-21	53-148	4-101	105	30	99	ref|YP_002000121.1|	hypothetical protein MARTH_orf636 [Mycoplasma arthritidis 15...
4558	Sorghum bicolor	2 (0.07%)	3E-29	43-131	154-243	133	29	90	ref|XP_002451811.1|	hypothetical protein SORBIDRAFT_04g008060 [Sorghum bicolor] ...
443143	Geobacter sp. M18	1 (0.04%)	3E-28	40-150	4-113	130	29	113	ref|YP_004200207.1|	hypothetical protein GM18_3497 [Geobacter sp. M18] ref|WP_01...
582899	Hyphomicrobium denitrificans ATCC 51888	1 (0.04%)	4E-27	44-153	54-156	126	29	110	ref|YP_003757599.1|	hypothetical protein Hden_3487 [Hyphomicrobium denitrificans...
637389	Acidithiobacillus caldus ATCC 51756	1 (0.04%)	9E-23	44-127	53-137	112	29	85	ref|WP_004870685.1|	metalloprotease [Acidithiobacillus caldus] gb|EET27341.1| hy...
42817	Corynebacterium argentoratense	1 (0.04%)	1E-39	18-152	32-168	167	28	143	ref|YP_008479185.1|	hypothetical protein CARG_07165 [Corynebacterium argentorate...
1087454	Corynebacterium pseudotuberculosis 1/06-A	1 (0.04%)	1E-36	36-152	1-121	158	28	126	ref|YP_005695086.1|	Metalloprotease [Corynebacterium pseudotuberculosis CIP 52.9...
1087453	Corynebacterium pseudotuberculosis 42/02-A	1 (0.04%)	1E-36	36-152	1-121	158	28	126	ref|YP_005693023.1|	metalloprotease [Corynebacterium pseudotuberculosis 42/02-A]...
428126	Clostridium spiroforme DSM 1552	1 (0.04%)	6E-36	1-153	1-149	155	28	158	ref|WP_004610339.1|	rRNA maturation factor [[Clostridium] spiroforme] gb|EDS7427...
1045004	Oenococcus kitaharae DSM 17330	1 (0.04%)	1E-35	6-147	1-148	155	28	148	ref|WP_007746517.1|	rRNA maturation factor [Oenococcus kitaharae] gb|EHN59544.1|...
330214	Candidatus Nitrospira defluvii	1 (0.04%)	6E-33	30-146	21-139	145	28	119	ref|YP_003799682.1|	hypothetical protein NIDE4088 [Candidatus Nitrospira defluvi...
29760	Vitis vinifera	3 (0.11%)	8E-32	36-131	1073-1169	142	28	97	ref|XP_002278343.1|	PREDICTED: receptor-like protein kinase HSL1-like [Vitis vin...
1303729	Leptospira borgpetersenii serovar Hardjo-bovis str. Sponselee	1 (0.04%)	1E-27	31-152	7-143	128	28	138	ref|YP_797684.1|	metal-dependent hydrolase [Leptospira borgpetersenii serovar...
590168	Thermotoga naphthophila RKU-10	1 (0.04%)	7E-27	22-153	15-138	125	28	132	ref|YP_001244873.1|	hypothetical protein Tpet_1283 [Thermotoga petrophila RKU-1]...
379066	Gemmatimonas aurantiaca T-27	1 (0.04%)	5E-26	44-149	56-160	122	28	107	ref|YP_002761225.1|	hypothetical protein GAU_1713 [Gemmatimonas aurantiaca T-27]...
123214	Persephonella marina EX-H1	1 (0.04%)	2E-24	3-152	2-147	117	28	151	ref|YP_002731717.1|	hypothetical protein PERMA_1963 [Persephonella marina EX-H1]...
416591	Thermotoga lettingae TMO	1 (0.04%)	1E-23	37-148	5-110	115	28	112	ref|YP_001471588.1|	hypothetical protein Tlet_1970 [Thermotoga lettingae TMO] re...
997886	Bacteroides ovatus CL03T12C18	1 (0.04%)	2E-22	43-144	37-134	111	28	102	ref|WP_004298035.1|	rRNA maturation factor [Bacteroides] gb|EDO13359.1| translat...