old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190
	MKKVIIVDASVTPSGSYTHLLLDRFLQTYKKQNSSVEFIDWNLNELPVGKISYNTQNASNFFSFENSDYYIDALKTAYGIVILAPMTNFNYPASLKNFIDHVFVANKTFQDKYVTKGASKGLLTNLKVVVLASQGAPLGWYPWADHVSNLKGLFGFAGVTHFESVLIDDTKILYKDKNKQEVVDLFAHKVDQVANNF
tmhmm (0)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (4%)	-------------XX-------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXX-------------
psipred	--EEEEEE--------HHHHHHHHHHHHHHH----EEEEEEE-------HHHHHHHHHHH-----HHHHHHHHHH---EEEEE---------HHHHHHHHHHHHH-------------HH------EEEEE--------------HHHHHHHHH------EEEEEEEE-------HHHHHHHHHHHHHHHHHHHH--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    61	    0.118
  max. Y     8	    0.172
  max. S     3	    0.347
  mean S     1-7    0.303
       D     1-7    0.223    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.223 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-197	alignment	4r81A_201	1-199	0.8160	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	2E-46	1-197	1-197	191	100	197	ref|YP_006599878.1|	putative NAD(P)H dehydrogenase (quinone) [Mycoplasma genital...
662946	Mycoplasma genitalium M6282	1 (0.03%)	3E-46	1-197	1-197	190	99	197	ref|YP_006600364.1|	NAD(P)H dehydrogenase (quinone) [Mycoplasma genitalium M6282...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	6E-45	1-197	1-197	186	77	197	ref|NP_110167.1|	ACP phosphodieterase [Mycoplasma pneumoniae M129] ref|YP_005...
743965	Mycoplasma putrefaciens KS1	1 (0.03%)	4E-39	1-197	1-199	166	41	199	ref|YP_004789923.1|	FMN-dependent NADH-azoreductase [Mycoplasma putrefaciens KS1...
347256	Mycoplasma hominis ATCC 23114	1 (0.03%)	4E-35	1-197	1-197	153	41	200	ref|YP_003302623.1|	ACP phosphodieterase [Mycoplasma hominis ATCC 23114] ref|WP_...
708616	Mycoplasma gallisepticum str. F	1 (0.03%)	4E-41	1-197	1-197	173	40	198	ref|NP_853306.2|	azoreductase [Mycoplasma gallisepticum str. R(low)] ref|YP_0...
1159204	Mycoplasma gallisepticum NC08_2008.031-4-3P	1 (0.03%)	6E-41	1-197	1-197	173	40	198	ref|YP_006581409.1|	FMN-dependent NADH-azoreductase [Mycoplasma gallisepticum VA...
243272	Mycoplasma arthritidis 158L3-1	1 (0.03%)	5E-38	1-197	1-196	163	39	198	ref|YP_001999776.1|	azoreductase [Mycoplasma arthritidis 158L3-1] ref|WP_0124980...
767465	Mycoplasma bovis HB0801	1 (0.03%)	4E-32	2-197	5-200	143	39	197	ref|YP_004056186.1|	acyl carrier protein phosphodiesterase [Mycoplasma bovis PG4...
2110	Mycoplasma agalactiae	1 (0.03%)	4E-32	2-197	5-200	143	39	197	ref|YP_003515679.1|	acyl carrier protein phosphodiesterase [Mycoplasma agalactia...
347257	Mycoplasma agalactiae PG2	1 (0.03%)	1E-31	2-197	5-200	141	39	197	ref|YP_001256607.1|	Acyl carrier protein phosphodiesterase [Mycoplasma agalactia...
1188246	Mycoplasma mycoides subsp. capri PG3	1 (0.03%)	7E-36	1-197	1-199	156	38	199	ref|YP_004399733.1|	putative acyl carrier protein phosphodiesterase [Mycoplasma ...
865867	Mycoplasma mycoides subsp. mycoides SC str. Gladysdale	1 (0.03%)	1E-35	1-197	1-199	155	38	199	ref|YP_007810812.1|	NAD(P)H dehydrogenase (quinone) [Mycoplasma mycoides subsp. ...
1129368	Spiroplasma melliferum IPMB4A	1 (0.03%)	2E-39	3-197	4-200	168	37	198	ref|WP_004028105.1|	azoreductase [Spiroplasma melliferum] gb|EHJ90933.1| azoredu...
2133	Spiroplasma citri	1 (0.03%)	3E-39	3-197	4-200	167	37	198	emb|CAK99178.1|	hypothetical acyl carrier protein phosphodiesterase 1 [Spiro...
747682	Mycoplasma alligatoris A21JP2	1 (0.03%)	8E-31	1-197	1-200	139	36	200	ref|WP_005683080.1|	FMN-dependent NADH-azoreductase [Mycoplasma alligatoris] gb|...
512564	Mycoplasma crocodyli MP145	1 (0.03%)	2E-27	1-197	1-200	128	36	200	ref|YP_003560114.1|	FMN-dependent NADH-azo-oxidoreductase [Mycoplasma crocodyli ...
943945	Mycoplasma fermentans M64	1 (0.03%)	5E-33	2-193	4-195	146	33	193	ref|YP_004137059.1|	fmn-dependent NADH-azoreductase [Mycoplasma fermentans M64] ...
637387	Mycoplasma fermentans JER	1 (0.03%)	5E-33	2-193	4-195	146	33	193	ref|YP_003923037.1|	[Acyl-carrier-protein] phosphodiesterase [Mycoplasma ferment...
496833	Mycoplasma fermentans PG18	1 (0.03%)	6E-33	2-193	13-204	146	33	193	ref|YP_007762498.1|	hypothetical protein [Mycoplasma fermentans PG18] ref|WP_015...