| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 |
| | MKKVIIVDASVTPSGSYTHLLLDRFLQTYKKQNSSVEFIDWNLNELPVGKISYNTQNASNFFSFENSDYYIDALKTAYGIVILAPMTNFNYPASLKNFIDHVFVANKTFQDKYVTKGASKGLLTNLKVVVLASQGAPLGWYPWADHVSNLKGLFGFAGVTHFESVLIDDTKILYKDKNKQEVVDLFAHKVDQVANNF |
| tmhmm (0) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (4%) | -------------XX-------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXX------------- |
| psipred | --EEEEEE--------HHHHHHHHHHHHHHH----EEEEEEE-------HHHHHHHHHHH-----HHHHHHHHHH---EEEEE---------HHHHHHHHHHHHH-------------HH------EEEEE--------------HHHHHHHHH------EEEEEEEE-------HHHHHHHHHHHHHHHHHHHH-- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.03%) | 2E-46 | 1-197 | 1-197 | 191 | 100 | 197 | ref|YP_006599878.1| | putative NAD(P)H dehydrogenase (quinone) [Mycoplasma genital... |
| 662946 | Mycoplasma genitalium M6282 | 1 (0.03%) | 3E-46 | 1-197 | 1-197 | 190 | 99 | 197 | ref|YP_006600364.1| | NAD(P)H dehydrogenase (quinone) [Mycoplasma genitalium M6282... |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.03%) | 6E-45 | 1-197 | 1-197 | 186 | 77 | 197 | ref|NP_110167.1| | ACP phosphodieterase [Mycoplasma pneumoniae M129] ref|YP_005... |
| 743965 | Mycoplasma putrefaciens KS1 | 1 (0.03%) | 4E-39 | 1-197 | 1-199 | 166 | 41 | 199 | ref|YP_004789923.1| | FMN-dependent NADH-azoreductase [Mycoplasma putrefaciens KS1... |
| 347256 | Mycoplasma hominis ATCC 23114 | 1 (0.03%) | 4E-35 | 1-197 | 1-197 | 153 | 41 | 200 | ref|YP_003302623.1| | ACP phosphodieterase [Mycoplasma hominis ATCC 23114] ref|WP_... |
| 708616 | Mycoplasma gallisepticum str. F | 1 (0.03%) | 4E-41 | 1-197 | 1-197 | 173 | 40 | 198 | ref|NP_853306.2| | azoreductase [Mycoplasma gallisepticum str. R(low)] ref|YP_0... |
| 1159204 | Mycoplasma gallisepticum NC08_2008.031-4-3P | 1 (0.03%) | 6E-41 | 1-197 | 1-197 | 173 | 40 | 198 | ref|YP_006581409.1| | FMN-dependent NADH-azoreductase [Mycoplasma gallisepticum VA... |
| 243272 | Mycoplasma arthritidis 158L3-1 | 1 (0.03%) | 5E-38 | 1-197 | 1-196 | 163 | 39 | 198 | ref|YP_001999776.1| | azoreductase [Mycoplasma arthritidis 158L3-1] ref|WP_0124980... |
| 767465 | Mycoplasma bovis HB0801 | 1 (0.03%) | 4E-32 | 2-197 | 5-200 | 143 | 39 | 197 | ref|YP_004056186.1| | acyl carrier protein phosphodiesterase [Mycoplasma bovis PG4... |
| 2110 | Mycoplasma agalactiae | 1 (0.03%) | 4E-32 | 2-197 | 5-200 | 143 | 39 | 197 | ref|YP_003515679.1| | acyl carrier protein phosphodiesterase [Mycoplasma agalactia... |
| 347257 | Mycoplasma agalactiae PG2 | 1 (0.03%) | 1E-31 | 2-197 | 5-200 | 141 | 39 | 197 | ref|YP_001256607.1| | Acyl carrier protein phosphodiesterase [Mycoplasma agalactia... |
| 1188246 | Mycoplasma mycoides subsp. capri PG3 | 1 (0.03%) | 7E-36 | 1-197 | 1-199 | 156 | 38 | 199 | ref|YP_004399733.1| | putative acyl carrier protein phosphodiesterase [Mycoplasma ... |
| 865867 | Mycoplasma mycoides subsp. mycoides SC str. Gladysdale | 1 (0.03%) | 1E-35 | 1-197 | 1-199 | 155 | 38 | 199 | ref|YP_007810812.1| | NAD(P)H dehydrogenase (quinone) [Mycoplasma mycoides subsp. ... |
| 1129368 | Spiroplasma melliferum IPMB4A | 1 (0.03%) | 2E-39 | 3-197 | 4-200 | 168 | 37 | 198 | ref|WP_004028105.1| | azoreductase [Spiroplasma melliferum] gb|EHJ90933.1| azoredu... |
| 2133 | Spiroplasma citri | 1 (0.03%) | 3E-39 | 3-197 | 4-200 | 167 | 37 | 198 | emb|CAK99178.1| | hypothetical acyl carrier protein phosphodiesterase 1 [Spiro... |
| 747682 | Mycoplasma alligatoris A21JP2 | 1 (0.03%) | 8E-31 | 1-197 | 1-200 | 139 | 36 | 200 | ref|WP_005683080.1| | FMN-dependent NADH-azoreductase [Mycoplasma alligatoris] gb|... |
| 512564 | Mycoplasma crocodyli MP145 | 1 (0.03%) | 2E-27 | 1-197 | 1-200 | 128 | 36 | 200 | ref|YP_003560114.1| | FMN-dependent NADH-azo-oxidoreductase [Mycoplasma crocodyli ... |
| 943945 | Mycoplasma fermentans M64 | 1 (0.03%) | 5E-33 | 2-193 | 4-195 | 146 | 33 | 193 | ref|YP_004137059.1| | fmn-dependent NADH-azoreductase [Mycoplasma fermentans M64] ... |
| 637387 | Mycoplasma fermentans JER | 1 (0.03%) | 5E-33 | 2-193 | 4-195 | 146 | 33 | 193 | ref|YP_003923037.1| | [Acyl-carrier-protein] phosphodiesterase [Mycoplasma ferment... |
| 496833 | Mycoplasma fermentans PG18 | 1 (0.03%) | 6E-33 | 2-193 | 13-204 | 146 | 33 | 193 | ref|YP_007762498.1| | hypothetical protein [Mycoplasma fermentans PG18] ref|WP_015... |