| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 |
| | MVVGIGIDVVQLKRFLTLVETSDCFAKRLLTSNELNSYWKLNNNQRANFLAVHWTLKEAIYKATSHIKPLFTKLEIYKLNNQYRCEFIQNINLLLSVSYTNCHVSAICLAQQNG |
| tmhmm (0) | ------------------------------------------------------------------------------------------------------------------ |
| low complexity (0%) | ------------------------------------------------------------------------------------------------------------------ |
| coiled-coils (0%) | ------------------------------------------------------------------------------------------------------------------ |
| disordered (0%) | ------------------------------------------------------------------------------------------------------------------ |
| psipred | -EEEEEEEE--HHHHHHHHHH-HHHHHH---HHHHHHHHH----HHHHHHHHHHHHHHHHHHHH-------EEEEEEE--------EE----EEEEEE----EEEEEEEEEE-- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 1095736 | Streptococcus mitis SK575 | 1 (0.04%) | 3E-33 | 1-113 | 1-117 | 146 | 34 | 119 | ref|WP_000635002.1| | 4'-phosphopantetheinyl transferase [Streptococcus mitis] gb|... |
| 747682 | Mycoplasma alligatoris A21JP2 | 1 (0.04%) | 1E-15 | 5-111 | 2-99 | 88 | 34 | 107 | ref|WP_005683184.1| | ACP synthase [Mycoplasma alligatoris] gb|EFF41761.1| phospho... |
| 871237 | Streptococcus infantis SK1302 | 1 (0.04%) | 6E-34 | 1-113 | 13-129 | 149 | 33 | 119 | ref|WP_000418771.1| | 4'-phosphopantetheinyl transferase [Streptococcus infantis] ... |
| 1005705 | Streptococcus infantis SK1076 | 1 (0.04%) | 7E-34 | 1-113 | 13-129 | 148 | 33 | 119 | ref|WP_006150840.1| | 4'-phosphopantetheinyl transferase [Streptococcus infantis] ... |
| 1203590 | Streptococcus sp. HPH0090 | 1 (0.04%) | 7E-34 | 1-113 | 13-129 | 148 | 33 | 119 | ref|WP_016466220.1| | holo-[acyl-carrier-protein] synthase [Streptococcus sp. HPH0... |
| 314282 | Psychromonas sp. CNPT3 | 1 (0.04%) | 2E-5 | 5-67 | 113-171 | 54 | 33 | 63 | ref|YP_007640401.1| | 4'-phosphopantetheinyl transferase [Psychromonas sp. CNPT3] ... |
| 1313 | Streptococcus pneumoniae | 2 (0.08%) | 6E-35 | 1-113 | 53-169 | 152 | 32 | 119 | ref|WP_023928366.1| | 4'-phosphopantetheinyl transferase [Streptococcus pneumoniae... |
| 997830 | Streptococcus infantis X | 1 (0.04%) | 3E-34 | 1-113 | 13-129 | 150 | 32 | 119 | ref|WP_006153131.1| | 4'-phosphopantetheinyl transferase [Streptococcus infantis] ... |
| 28037 | Streptococcus mitis | 4 (0.16%) | 2E-34 | 1-113 | 34-150 | 150 | 32 | 119 | ref|WP_023946128.1| | 4'-phosphopantetheinyl transferase [Streptococcus mitis] gb|... |
| 1035189 | Streptococcus infantis SK970 | 1 (0.04%) | 1E-33 | 1-113 | 13-129 | 148 | 32 | 119 | ref|WP_006154551.1| | 4'-phosphopantetheinyl transferase [Streptococcus infantis] ... |
| 1159208 | Streptococcus mitis SPAR10 | 1 (0.04%) | 8E-34 | 1-113 | 1-117 | 148 | 32 | 119 | ref|WP_004250798.1| | 4'-phosphopantetheinyl transferase [Streptococcus mitis] gb|... |
| 1090974 | Melissococcus plutonius DAT561 | 1 (0.04%) | 8E-29 | 1-111 | 1-116 | 131 | 32 | 117 | ref|YP_004456879.1| | holo-ACP synthase [Melissococcus plutonius ATCC 35311] ref|Y... |
| 1095383 | Geobacillus sp. A8 | 1 (0.04%) | 1E-35 | 1-114 | 1-119 | 154 | 31 | 121 | ref|YP_146081.1| | 4'-phosphopantetheinyl transferase [Geobacillus kaustophilus... |
| 1169675 | Streptococcus sp. GMD6S | 1 (0.04%) | 5E-34 | 1-113 | 1-117 | 149 | 31 | 117 | ref|WP_008293557.1| | 4'-phosphopantetheinyl transferase [Streptococcus sp. GMD6S]... |
| 1169674 | Streptococcus sp. GMD5S | 1 (0.04%) | 4E-34 | 1-113 | 3-119 | 149 | 31 | 117 | ref|WP_000061844.1| | 4'-phosphopantetheinyl transferase [Streptococcus sp. GMD5S] |
| 1000588 | Streptococcus mitis bv. 2 str. SK95 | 1 (0.04%) | 1E-33 | 1-113 | 3-119 | 148 | 31 | 117 | ref|WP_000061848.1| | 4'-phosphopantetheinyl transferase [Streptococcus mitis] gb|... |
| 1095726 | Streptococcus sp. SK140 | 1 (0.04%) | 9E-33 | 1-113 | 13-129 | 145 | 31 | 119 | ref|WP_000424624.1| | 4'-phosphopantetheinyl transferase [Streptococcus sp. SK140]... |
| 563037 | Streptococcus sp. M143 | 1 (0.04%) | 7E-33 | 1-113 | 3-119 | 145 | 31 | 117 | ref|WP_000605344.1| | 4'-phosphopantetheinyl transferase [Streptococcus sp. M143] ... |
| 1158608 | Enterococcus haemoperoxidus ATCC BAA-382 | 1 (0.04%) | 5E-32 | 1-111 | 1-115 | 142 | 31 | 115 | ref|WP_010762591.1| | holo-[acyl-carrier-protein] synthase [Enterococcus haemopero... |
| 89059 | Lactobacillus acidipiscis | 1 (0.04%) | 5E-30 | 1-112 | 1-119 | 135 | 31 | 119 | ref|WP_010499646.1| | 4'-phosphopantetheinyl transferase [Lactobacillus acidipisci... |