old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110
	MVVGIGIDVVQLKRFLTLVETSDCFAKRLLTSNELNSYWKLNNNQRANFLAVHWTLKEAIYKATSHIKPLFTKLEIYKLNNQYRCEFIQNINLLLSVSYTNCHVSAICLAQQNG
tmhmm (0)	------------------------------------------------------------------------------------------------------------------
low complexity (0%)	------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------
disordered (0%)	------------------------------------------------------------------------------------------------------------------
psipred	-EEEEEEEE--HHHHHHHHHH-HHHHHH---HHHHHHHHH----HHHHHHHHHHHHHHHHHHHH-------EEEEEEE--------EE----EEEEEE----EEEEEEEEEE--

# SignalP-4.0 euk predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    27	    0.216
  max. Y     2	    0.178
  max. S     1	    0.311
  mean S     1-1    0.311
       D     1-1    0.250    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.250 D-cutoff=0.450 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-114	alignment	5xumA_203	1-168	0.8399	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
1095736	Streptococcus mitis SK575	1 (0.04%)	3E-33	1-113	1-117	146	34	119	ref|WP_000635002.1|	4'-phosphopantetheinyl transferase [Streptococcus mitis] gb|...
747682	Mycoplasma alligatoris A21JP2	1 (0.04%)	1E-15	5-111	2-99	88	34	107	ref|WP_005683184.1|	ACP synthase [Mycoplasma alligatoris] gb|EFF41761.1| phospho...
871237	Streptococcus infantis SK1302	1 (0.04%)	6E-34	1-113	13-129	149	33	119	ref|WP_000418771.1|	4'-phosphopantetheinyl transferase [Streptococcus infantis] ...
1005705	Streptococcus infantis SK1076	1 (0.04%)	7E-34	1-113	13-129	148	33	119	ref|WP_006150840.1|	4'-phosphopantetheinyl transferase [Streptococcus infantis] ...
1203590	Streptococcus sp. HPH0090	1 (0.04%)	7E-34	1-113	13-129	148	33	119	ref|WP_016466220.1|	holo-[acyl-carrier-protein] synthase [Streptococcus sp. HPH0...
314282	Psychromonas sp. CNPT3	1 (0.04%)	2E-5	5-67	113-171	54	33	63	ref|YP_007640401.1|	4'-phosphopantetheinyl transferase [Psychromonas sp. CNPT3] ...
1313	Streptococcus pneumoniae	2 (0.08%)	6E-35	1-113	53-169	152	32	119	ref|WP_023928366.1|	4'-phosphopantetheinyl transferase [Streptococcus pneumoniae...
997830	Streptococcus infantis X	1 (0.04%)	3E-34	1-113	13-129	150	32	119	ref|WP_006153131.1|	4'-phosphopantetheinyl transferase [Streptococcus infantis] ...
28037	Streptococcus mitis	4 (0.16%)	2E-34	1-113	34-150	150	32	119	ref|WP_023946128.1|	4'-phosphopantetheinyl transferase [Streptococcus mitis] gb|...
1035189	Streptococcus infantis SK970	1 (0.04%)	1E-33	1-113	13-129	148	32	119	ref|WP_006154551.1|	4'-phosphopantetheinyl transferase [Streptococcus infantis] ...
1159208	Streptococcus mitis SPAR10	1 (0.04%)	8E-34	1-113	1-117	148	32	119	ref|WP_004250798.1|	4'-phosphopantetheinyl transferase [Streptococcus mitis] gb|...
1090974	Melissococcus plutonius DAT561	1 (0.04%)	8E-29	1-111	1-116	131	32	117	ref|YP_004456879.1|	holo-ACP synthase [Melissococcus plutonius ATCC 35311] ref|Y...
1095383	Geobacillus sp. A8	1 (0.04%)	1E-35	1-114	1-119	154	31	121	ref|YP_146081.1|	4'-phosphopantetheinyl transferase [Geobacillus kaustophilus...
1169675	Streptococcus sp. GMD6S	1 (0.04%)	5E-34	1-113	1-117	149	31	117	ref|WP_008293557.1|	4'-phosphopantetheinyl transferase [Streptococcus sp. GMD6S]...
1169674	Streptococcus sp. GMD5S	1 (0.04%)	4E-34	1-113	3-119	149	31	117	ref|WP_000061844.1|	4'-phosphopantetheinyl transferase [Streptococcus sp. GMD5S]
1000588	Streptococcus mitis bv. 2 str. SK95	1 (0.04%)	1E-33	1-113	3-119	148	31	117	ref|WP_000061848.1|	4'-phosphopantetheinyl transferase [Streptococcus mitis] gb|...
1095726	Streptococcus sp. SK140	1 (0.04%)	9E-33	1-113	13-129	145	31	119	ref|WP_000424624.1|	4'-phosphopantetheinyl transferase [Streptococcus sp. SK140]...
563037	Streptococcus sp. M143	1 (0.04%)	7E-33	1-113	3-119	145	31	117	ref|WP_000605344.1|	4'-phosphopantetheinyl transferase [Streptococcus sp. M143] ...
1158608	Enterococcus haemoperoxidus ATCC BAA-382	1 (0.04%)	5E-32	1-111	1-115	142	31	115	ref|WP_010762591.1|	holo-[acyl-carrier-protein] synthase [Enterococcus haemopero...
89059	Lactobacillus acidipiscis	1 (0.04%)	5E-30	1-112	1-119	135	31	119	ref|WP_010499646.1|	4'-phosphopantetheinyl transferase [Lactobacillus acidipisci...